KEGG   Rattus norvegicus (rat): 361710
Entry
361710            CDS       T01003                                 

Gene name
Sipa1
Definition
(RefSeq) signal-induced proliferation-associated protein 1
  KO
K08013  signal-induced proliferation-associated gene 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04015  Rap1 signaling pathway
rno04670  Leukocyte transendothelial migration
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    361710 (Sipa1)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    361710 (Sipa1)
SSDB
Motif
Pfam: Rap_GAP PDZ ZapB Rab5-bind PDZ_6 PI3K_P85_iSH2 ERM
Other DBs
NCBI-GeneID: 361710
NCBI-ProteinID: NP_001004089
RGD: 1303184
Ensembl: ENSRNOG00000020726
UniProt: Q6I7S1
Position
1
AA seq 1040 aa
MWAGGVGSPRRGMAPAPTDDLFARKLRQPARPPLTPHTFEPRPARGPLLRSGSDAGEVRP
PTPASPRARAHSHEDTSRPAATPTRLFTDPLALLGLPAEEPEPTFPPVLEPRWFAHYDVQ
SLLFDWAPRPRATGSHTESNSGTLALAEDQTTTSDLLLGAPGFVSELGGEGELGLGGPIS
PPVPPALPNASVSVLEEPQTRTTAYSLEHADLGAGYYRKYFYGKEHQNFFGLDEALGPVA
VSLRREEKEGSGGGTLHSYRVIVRTTQLRTLRGTISEDALPPGPPRGLSPRKLLEHVAPR
LSPTCLRLGSASPKVPRTLLTLDEQVLSFQRKVGILYCRAGQGSEEEMYNNQEAGAAFMQ
FLTLLGDVVRLKGFENYRAQLDTKTDSTGAHSLYTTYQDHEIMFHVSTMLPYTPNNQQQL
LRKRHIGNDIVTIVFQEPGSKPFCPTTIRSHFQHVFLVVRAHAPCTPHTSYRVAVSRTQD
TPAFGPALPEGGGPFAANADFRAFLLAKALNGEQAAGHARQFHAMATRTRQQYLQDLATN
EVTTTSLDSASRFGLPSLGGRRRATPRSPGAELQAAGALMWGVRAAPGARVSAGAETGGP
DHAEVPCLLGISAETLVLVTPRDGRVVFNCACRDVLAWTFSDHQLDLYHGRGEAITLRLD
GAPGQAVGEVVARLQLVSRGCETRELALPRDGQGRLGFEVDAEGFITHVERFTFAETTGL
RPGARLLRVCGQTLPKLGPEAAAQMLRSASKVCVTVLPPDESGRPRRSFSELYTLSLKEP
SRRAAPEPEQDETEKLVTLPAAKQLLHFCLKDGGSPPGPGDLTEERTEFLHSHNSLSPRS
SMSDEAPVLPNTTPDLLLVTAVTTLAPGTDRETPPSQDQSGSSSSHEDTSDSAPELRASI
LPRTLSLRNSISKIMSEAGSETLEDEWQSISEIASTCNTILESLSREGQPILESGDPKET
SKCNSEPEPGSLSEKVSHLESMLRKLQEDLQREKADRAALEEEVRSLRHNNQRLLAESES
AATRLLLASKQLGSPTTDLA
NT seq 3123 nt   +upstreamnt  +downstreamnt
atgtgggccggcggtgtggggagccctcggcggggcatggcccctgcacctaccgatgac
ctctttgcccgtaagctgcgccaacccgcccggcccccactgacaccacatacttttgag
ccaaggccagctcgggggccactcctgcgcagtggcagtgatgctggtgaagtccggcct
cctacaccagccagcccccgtgcccgtgcccacagccatgaggataccagccgccctgct
gcaacccctactcggctcttcactgacccactggcactactggggttgccagctgaggag
ccagagcccaccttcccaccagtgctagaaccccgatggtttgctcactacgatgtgcag
agcttgctctttgactgggctccacgacctcgggcgacaggcagccataccgagtctaac
tctgggactctggccttagctgaggaccagactaccacctcagatctactgctcggggca
cctggctttgtgagcgagcttggtggggagggtgagctagggctgggtggaccaatatcc
ccacctgtgccccctgcactgcctaatgcgtctgtgtcagtcctggaggagccacagacc
cggaccacagcttacagcctggagcacgcagatctgggtgcaggctactaccgcaagtac
ttctatggcaaagaacaccagaacttctttgggctggatgaggcgctgggtccggtggca
gtgagcctacgacgggaggagaaagagggcagcggagggggcaccctacacagttatcgg
gtcatcgtacggaccacgcagctccggactctccgtggcaccatctcggaggatgcactg
cctcccggccccccgaggggcctatctccgaggaagcttctggaacacgtggctccacgg
ctgagcccaacctgcctgcgcctgggttcagcctctcccaaggtgccccgcacgctgctt
actctagatgagcaagtgctgagtttccaacgcaaggtgggcatcctgtactgccgggcc
ggccaaggctctgaggaagagatgtacaacaaccaggaagccggagcagccttcatgcag
ttcctcaccctgctgggtgatgtggtgcgactcaaaggcttcgagaattaccgggcccag
ctggataccaaaacggattccacgggcgcacattcactctataccacctaccaagaccat
gagatcatgtttcacgtgtccacgatgctgccttacacgcctaataaccagcaacagctc
ctgaggaagcgtcatatcggcaatgatattgtgaccatcgtgttccaggagccgggtagc
aagcccttctgccccacaactatccgctctcacttccagcacgttttcttggtggtgcgt
gcgcatgccccctgcaccccacacacctcatacagggtggcagtgagccgcacacaggac
actcctgccttcgggccggcgctgccagaaggcggaggcccctttgcagccaatgctgat
ttccgggcctttctgttggccaaggcactcaatggtgagcaagcggccggtcatgcacgc
cagttccacgccatggctacacgcacacgtcaacagtacctgcaggacctggctactaat
gaagtgaccactacttcgctggattcggcttcgcggtttggcctaccatctctggggggc
aggcgccgggcaacccctcggagcccaggcgcagagctgcaggcggcgggcgcgctaatg
tggggcgtgcgcgcggctccaggggcgcgggtctcagcgggagctgaaacaggcggccca
gaccacgccgaggtgccatgcttgttgggcatctcagcagagaccctggtgctagtgaca
cctcgcgacggccgcgtggtcttcaattgtgcctgtcgcgatgtattggcctggaccttc
tcagaccatcaacttgatctataccacgggcgcggagaggcgatcacgctacgactcgac
ggggccccagggcaagccgtgggcgaagtcgtggcacgtctgcagctggtgagccggggc
tgtgagaccagagaactagccctgcccagagatggccaaggtcgcctgggcttcgaggtg
gatgcagagggtttcatcacgcacgtggaacgcttcacgttcgcggagaccacggggctt
cggcctggagcacgtctgctgcgcgtatgtggccagacgctgcccaagctgggtccagaa
gctgctgcccagatgctgcgctctgcgtccaaggtctgcgtcacggtcctgcccccagat
gagagcggccggccgcgaaggagcttttccgagctgtacacgctgtctctgaaggaaccc
agccgccgtgcggccccagagccagaacaagatgagactgagaagctggtcaccttgccc
gctgcaaagcagctgctacatttttgcctgaaggacggtggtagtcctccggggcctggg
gatctcactgaggagaggacagagttcctgcacagccacaactccctgtcacctcgcagc
tccatgtccgatgaggctccagtcctgcccaacaccactccagacctcctcctcgtcacc
gctgtcaccacattggcacccggtactgacagagagacgcccccttcccaggaccagtcg
ggaagctccagtagtcatgaagacaccagtgactcggcaccagaattgagggcctccatc
ctgcccagaaccttgtctcttcggaattccatcagtaaaattatgtcagaagccggcagc
gagaccctggaggatgagtggcagtccatctcagagatcgcctccacttgcaacacaatt
ctggagtcactgtcccgggagggacagcccatcctagagagtggagaccccaaggaaact
tcaaagtgtaattctgagccagaacctgggagcctgtcagaaaaggtctctcacctagag
tccatgctgaggaagctccaggaggacctgcagagggagaaggcggacagggcagccctg
gaggaagaggttcggagcctcagacacaacaaccagaggctgctggcggagtcagagagt
gccgccacccgcctgctcctggcctctaagcagctgggttcacccactactgaccttgcc
tga

DBGET integrated database retrieval system