KEGG   Rattus norvegicus (rat): 361714
Entry
361714            CDS       T01003                                 

Gene name
Rasgrp2
Definition
(RefSeq) RAS guanyl-releasing protein 2
  KO
K12361  RAS guanyl-releasing protein 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
rno04062  Chemokine signaling pathway
rno04611  Platelet activation
rno05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    361714 (Rasgrp2)
   04014 Ras signaling pathway
    361714 (Rasgrp2)
   04015 Rap1 signaling pathway
    361714 (Rasgrp2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    361714 (Rasgrp2)
   04062 Chemokine signaling pathway
    361714 (Rasgrp2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    361714 (Rasgrp2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:rno04990]
    361714 (Rasgrp2)
Domain-containing proteins not elsewhere classified [BR:rno04990]
 EF-hand domain-containing proteins
  Other EF-hand domain-containing proteins
   361714 (Rasgrp2)
SSDB
Motif
Pfam: RasGEF C1_1 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_7 RasGEF_N EF-hand_8
Other DBs
NCBI-GeneID: 361714
NCBI-ProteinID: NP_001076446
RGD: 1311630
Ensembl: ENSRNOG00000021098
UniProt: P0C643
Position
1
AA seq 608 aa
MASTLDLDKGCTVEELLRGCIEAFDDSGKVRDPQLVRMFLMMHPWYIPSSQLASKLLHFY
QQSRKDNSNSLQVKTCHLVRYWVSAFPAEFDLNPELAEQIKELKALLDQEGNRRHSSLID
IESVPTYKWKRQVTQRNPVEQKKRKMSLLFDHLEPMELAEHLTYLEYRSFCKILFQDYHS
FVTHGCTVDNPVLERFISLFNSVSQWVQLMILSKPTATQRALVITHFVHVAEKLLQLQNF
NTLMAVVGGLSHSSISRLKETHSHVSPDTIKLWEGLTELVTATGNYSNYRRRLAACVGFR
FPILGVHLKDLVALQLALPDWLDPGRTRLNGAKMRQLFSILEELAMVTSLRPPVQANPDL
LSLLTVSLDQYQTEDELYQLSLQREPRSKSSPTSPTSCTPPPRPPVLEEWTSVAKPKLDQ
ALVAEHIEKMVESVFRNFDVDGDGHISQEEFQIIRGNFPYLSAFGDLDQNQDGCISREEM
ISYFLRSSSVLGGRMGFVHNFQESNSLRPVACRHCKALILGIYKQGLKCRACGVNCHKQC
KDRLSVECRRRAQSVSLEGSAPSPSPTHTHHRAFSFSLPRPGRRSSRPPEIREEEVQTVE
DGVFDIHL
NT seq 1827 nt   +upstreamnt  +downstreamnt
atggcgagcactctggacctggacaagggttgcaccgtggaggagctgctccgtggctgt
atcgaagcctttgatgactctggaaaggtgcgagatccacagctagtgcgcatgtttctc
atgatgcacccctggtacataccttcctctcagctggcttcgaaactgctccacttctat
cagcaatcccggaaggacaactccaattccctacaggtgaaaacctgtcacctggtcagg
tactgggtctcagccttcccagcagagttcgacttgaacccagagctggctgaacagatc
aaggagctgaaggctctgttagaccaagaaggaaaccgcaggcacagcagcctcatcgac
atcgagagtgtccccacctacaagtggaagcggcaggtgacccagcggaaccctgtggaa
cagaaaaagcgcaagatgtccctgttgtttgatcacttggagcctatggaactggcagaa
catctcacctacttggagtatcggtccttctgcaagatcctgttccaggactatcacagc
tttgtgactcatggctgcactgtagacaatccggtcctggagcgattcatctccctcttc
aacagtgtctctcagtgggtccaactcatgatcctcagcaagcccacagccacgcagcgg
gcgctggtcatcacacatttcgtgcatgtggcagagaagctgctgcagctgcagaacttc
aacacgttgatggccgtcgtgggaggcctgagccacagctccatctcacgcctcaaggag
acccacagccatgtcagccctgacaccatcaagctctgggaaggtctgacagaactagtg
acagctactggcaactacagcaactaccggcgaaggctggcggcctgcgtgggcttccgc
tttcctatcctgggtgtgcacctcaaggatctagtggctctgcagctggctctgcctgac
tggctggacccaggtcggacccggctcaatggagccaagatgaggcagcttttcagcatt
ctggaggagttggctatggtgaccagtcttcgaccaccagtgcaagccaaccccgacctg
ctgagtctgctcacggtgtccctggaccagtatcagacggaggatgagctgtatcagctc
tctctgcagcgagagccacgttccaagtcatcgcccaccagccccaccagctgcaccccg
cctccccggccgcctgtgctggaagagtggacctcagttgccaagcctaagctggaccaa
gccttggtggccgagcacattgagaagatggtggagtctgtgttccggaactttgacgtt
gatggggacggtcacatctcccaggaggagttccagatcatccggggcaacttcccttat
ctcagcgcctttggggacttggaccagaaccaggatggctgcatcagccgcgaggagatg
atctcctacttcctgcgctccagctcggtgctgggaggccgcatgggcttcgtacacaac
ttccaggagagtaactcgctaaggccggtcgcctgccgacactgcaaagctctgatcctg
ggcatctacaagcagggcctcaaatgtagagcttgtggtgtgaactgccacaagcagtgc
aaagaccgactgtcagtggaatgtcgccgccgcgcccagagtgtgagcctggagggctct
gcaccctctccctcacccacacatacccaccatcgggccttcagcttctccctgcctcgc
ccaggcaggcgcagctctcggcctccagagatccgtgaagaggaggtgcagactgtggaa
gatggtgtgttcgacatccacttataa

DBGET integrated database retrieval system