KEGG   Rattus norvegicus (rat): 361715
Entry
361715            CDS       T01003                                 

Gene name
Rps6ka4, Ccdc88b
Definition
(RefSeq) ribosomal protein S6 kinase A4
  KO
K16510  ribosomal protein S6 kinase alpha-4 [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04668  TNF signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    361715 (Rps6ka4)
   04668 TNF signaling pathway
    361715 (Rps6ka4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    361715 (Rps6ka4)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     361715 (Rps6ka4)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   361715 (Rps6ka4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like APH Pkinase_fungal Kdo RIO1 Pkinase_C Haspin_kinase Choline_kinase
Other DBs
NCBI-GeneID: 361715
NCBI-ProteinID: NP_001101987
RGD: 1307277
Ensembl: ENSRNOG00000021117
UniProt: D3ZSB7
Position
1q43
AA seq 773 aa
MGDEDEDEGCAVELQITEANLTGHEEKVSVENFALLKVLGTGAYGKVFLVRKAGGHDAGK
LYAMKVLRKAALVQRAKTQEHTRTERSVLELVRQAPFLVTLHYAFQTDAKLHLILDYVSG
GEMFTHLYQRQYFKEAEVRVYGGEIVLALEHLHKLGIIYRDLKLENVLLDSEGHIVLTDF
GLSKEFLTEEKERTFSFCGTIEYMAPEIIRSKAGHGKAVDWWSLGILLFELLTGASPFTL
EGERNTQAEVSRRILKCSPPFPPRIGPVAQDLLQRLLCKDPKKRLGAGPQGAQEVKSHLF
FQGLDWVALAARKIPAPFRPQIRSELDVGNFAEEFTRLEPVYSPAGSPPPGDPRIFQGYS
FVAPSILFDHNNAVMADVLAAPGAGYRPGRAAVARSAMMQDSPFFQQYELDLREPALGQG
SFSVCRRCRQRQSGQEFAVKILSRRLEENTQREVAALRLCQSHPNVVNLHEVLHDQLHTY
LVLELLRGGELLEHIRKKRLFSESEASQILRSLVSAVSFMHEEAGVVHRDLKPENILYAD
DTPGAPVKIIDFGFARLRPQSPAGPMQTPCFTLQYAAPELLAQQGYDESCDLWSLGVILY
MMLSGQVPFQGASGQGGQSQAAEIMCKIREGRFSLDGEAWQGVSEEAKELVRGLLTVDPA
KRLKLEGLRSSSWLQDGSARSSPPLRTPDVLESSGPAVRSGLNATFMAFNRGKREGFFLK
SVENAPLAKRRKQKLRSAAASRRGSPVPASSGRLPASASKGTTRRANGPLSPS
NT seq 2322 nt   +upstreamnt  +downstreamnt
atgggagacgaggatgaggatgagggctgcgccgtggagctgcagatcaccgaagccaac
ctgaccgggcatgaggagaaggtgagcgtggagaacttcgcgctgctcaaggtgctgggc
acgggagcctacgggaaggtgttcctggtgcggaaggcgggtgggcacgatgcgggcaag
ctctatgccatgaaggtgcttcgcaaggcggcgttggtgcagcgcgccaagacgcaggag
catacccgcaccgaacgctcagtgctggagctggtacgccaggcacccttcctggtcaca
ctgcactacgccttccagacggacgccaaactgcacctcatcctggactatgtgagcggt
ggtgagatgttcactcacctgtaccagcgccagtacttcaaggaggctgaggtgcgagtg
tacgggggagagattgtgctggccctagagcacctgcacaagttgggcatcatctacagg
gacctgaagctggagaacgtcttacttgactctgaaggtcacattgtcctcacagacttt
ggtttgagcaaggagttcctgactgaggagaaagagcgaaccttctccttctgtggcacc
atcgagtacatggctcccgaaatcatccgaagcaaggctggacatggcaaggctgtggac
tggtggagcctgggtatcctgctcttcgagctgctgacaggagcctcacccttcacactg
gagggagaaaggaacactcaggctgaggtgtctcgacggatcttgaagtgctcccctccc
ttccctccccggattgggcctgtggcacaggacctgctacagcgcctgctgtgcaaggac
cctaagaagaggttgggcgcaggtccccagggtgcacaggaagtcaagagtcacctcttt
ttccagggtctggattgggttgctctggctgccagaaagatcccagccccattccggccc
cagatccgctcagagctggatgtggggaattttgcagaggaattcactcggctggagcct
gtctactcccctgctggcagccctccacctggggaccctaggatctttcagggatactcc
ttcgtggctccttccatactctttgaccacaacaacgcagtgatggctgatgtgctggcg
gcacctggtgctggatacaggcctggcagggcagcagttgccaggagtgccatgatgcag
gactcgcctttcttccagcagtatgagctggaccttcgggagccagcgctggggcagggc
agcttctctgtgtgtaggcgatgtcgccagcgccagagtggtcaggaatttgccgtcaag
atcctcagccgcaggctggaggagaacactcagcgcgaggtagctgcccttcgcttgtgc
cagtcacaccccaacgtggtgaacctgcatgaggtgcttcacgaccagttacacacttat
ctggtcctggagttgctgcggggcggggagctgctggagcacatccgcaagaagcgactc
ttcagcgagtccgaggctagccagatccttcggagcttggtgtcagccgtgagcttcatg
catgaggaggcgggcgtggtgcaccgtgacctgaaacccgagaacatcttgtacgcagac
gacactcctggggccccggtgaagatcatcgactttgggttcgcgagactgcggccccag
agcccggcggggcccatgcagacgccttgcttcaccctgcagtacgctgcacccgagctg
ctggcacagcaggggtacgacgagtcctgtgatctttggagcctgggtgtcattctgtac
atgatgctgtctggacaggttcccttccaaggggcctctggccagggtggacagagccag
gcagctgagatcatgtgcaagatccgtgaagggcgcttctctctggacggggaagcctgg
caaggtgtttcggaggaagccaaggagctggtccgagggctactgacagtggaccccgcc
aagcggctgaagctggaggggctgcgtagcagctcgtggcttcaggacggcagtgcgcgc
tcctcgcccccgctccgcacgccggatgtgctggagtcctctgggccagcagtgcgctcc
gggctcaatgccactttcatggcgtttaaccgaggaaagcgcgagggcttctttttgaag
agtgtggagaacgcgccgctggccaaaaggcgcaagcagaagctccggagcgcggccgcc
tcccgccgcggctccccggtgcctgcctcctcgggtcgcctaccagcctctgcctccaag
gggacaactcgccgagccaacggccccttgtccccttcttag

DBGET integrated database retrieval system