KEGG   Rattus norvegicus (rat): 361724
Entry
361724            CDS       T01003                                 

Gene name
Mta2
Definition
(RefSeq) metastasis associated 1 family, member 2
  KO
K11660  metastasis-associated protein MTA
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    361724 (Mta2)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Chromatin remodeling factors
   NuRD complex
    361724 (Mta2)
SSDB
Motif
Pfam: MTA_R1 BAH ELM2 GATA Myb_DNA-binding Myb_DNA-bind_7 Cytochrom_c3_2
Other DBs
NCBI-GeneID: 361724
NCBI-ProteinID: NP_001094210
RGD: 1306743
Ensembl: ENSRNOG00000019913
UniProt: B2GV01
Position
1q43
AA seq 668 aa
MAANMYRVGDYVYFENSSSNPYLVRRIEELNKTANGNVEAKVVCLFRRRDISSSLNSLAD
SNAREFEEESKQPGVSEQQRHQLKHRELFLSRQFESLPATHIRGKCSVTLLNETDILNQY
LEKEDCFFYSLVFDPVQKTLLADQGEIRVGCKFQAEIPDRLAEGESDNRNQQKMEMKVWD
PDNPLTDRQIDQFLVVARAVGTFARALDCSSSIRQPSLHMSAAAASRDITLFHAMDTLQR
NGYDLAKAMSTLVPQGGPVLCRDEMEEWSASEAMLFEEALEKYGKDFNDIRQDFLPWKSL
ASIVQFYYMWKTTDRYIQQKRLKAAEADSKLKQVYIPTYTKPNPNQIISVGSKPGMNGAG
FQKGLTCESCHTTQSAQWYAWGPPNMQCRLCASCWIYWKKYGGLKTPTQLEGAARGTTEP
HSRGHLSRPEAQSLSPYTTSANRAKLLAKNRQTFLLQTTKLTRLARRMCRDLLQPRRAAR
RPYAPINANAIKAECSIRLPKAAKTPLKIHPLARLPLAAIVKDLVAQAPLKPKTPRGTKT
PINRNQLTQNRGLGGIMVKRSYETMAGAGVPFSANGRPLASGIRSSSQPAAKRQKLNPAD
APNPVVFVATKDTRALRKALTHLEMRRAARRPNLPLKVKTALMTVRPPVPLPASSHPAST
NEPIVLED
NT seq 2007 nt   +upstreamnt  +downstreamnt
atggcggctaacatgtaccgggtaggagattatgtctattttgagaactcctccagcaat
ccttacctggttagacggattgaggagctcaataagactgcaaacggaaatgtggaagca
aaggttgtctgccttttccggcgaagggatatttctagtagcctcaacagcttggcggac
agcaatgctagggagtttgaggaggaatcaaaacagccaggggtctcggagcagcagaga
catcaactgaagcaccgagagctttttctttctcggcagtttgaatcattaccggccacc
cacataagggggaagtgcagtgtgactctcttgaacgagacggatatcttaaaccaatat
ctggaaaaggaggactgctttttttactcactggtgttcgaccctgtgcagaagacactt
ctggctgatcaaggggagatcagagttggttgcaaattccaagctgagatcccagatcgt
ttggcagagggagaatcggataatcgaaaccaacagaagatggagatgaaagtctgggac
ccagacaaccctctcacagaccggcagatcgatcagtttctcgtggtggcccgagccgtg
ggaacctttgccagagccctagactgcagcagctcaatccggcagccaagcttgcacatg
agtgcagctgctgcgtcccgagatatcaccctgttccatgccatggacacgttgcaaagg
aatggctatgacttggccaaggccatgtcaaccctggtgccacagggaggtccagtgctc
tgtcgggatgagatggaggaatggtctgcttctgaagctatgctgtttgaagaagctctg
gagaagtatgggaaggatttcaatgacatccgccaggactttctaccctggaagtcactt
gcaagcatagtccagttttattacatgtggaaaaccacagatcggtatattcagcagaaa
agactgaaagctgctgaagcagacagcaaactaaaacaggtctacatccccacttatact
aagccaaaccctaaccagatcatttctgtgggttcaaaacctggcatgaatggggctgga
ttccagaaaggcctgacttgtgagagctgccacaccacacagtctgcccagtggtatgct
tggggcccacctaacatgcagtgccgactttgtgcttcctgttggatttactggaagaag
tatggggggctgaagacaccgacccagcttgaaggggctgctcggggcaccacagagcca
cactcaagaggtcatttatccagacctgaagcccaaagtctctccccctatacaaccagt
gctaaccgggctaagttgctggctaagaacaggcaaactttcttgctccagaccacaaag
ctgactcgtcttgctagacggatgtgcagagacctgttacagccaaggagggctgcccga
agaccctatgcccccatcaatgccaacgccatcaaggcagagtgctctatccgacttcct
aaggctgccaagacaccgttgaagattcaccccctggcgagactgcccttggcagctatt
gtcaaagatctggtggctcaggcacctctgaaaccaaaaacacctcggggcaccaagaca
ccaatcaacagaaaccagctgacccagaatcgaggcctggggggcattatggtgaaacgt
tcctatgagactatggcaggggcaggggttcccttctctgccaatggaaggcctctggct
tcagggattcgttcaagctcacagccagcagccaagcgtcagaaactaaaccctgctgat
gctcccaatccagtggtatttgtggccacaaaggataccagggctttaaggaaagctcta
actcacctggaaatgcgccgagctgctcgaaggcccaacttacccctgaaggtgaagaca
gcgctgatgacagtgcggcccccagttcctctgccggcatcttcacatcctgctagcacc
aatgagcccattgtcctggaggattga

DBGET integrated database retrieval system