KEGG   Rattus norvegicus (rat): 361732
Entry
361732            CDS       T01003                                 

Gene name
Tmem109
Definition
(RefSeq) transmembrane protein 109
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: BRI3BP AA_kinase PEP-CTERM Clp_N
Other DBs
NCBI-GeneID: 361732
NCBI-ProteinID: NP_001007737
RGD: 1359538
Ensembl: ENSRNOG00000028017
UniProt: Q6AYQ4
Position
1q43
AA seq 243 aa
MAGAHSNPSWSRHLFKAVLMVLGALLLVHSASAQTHREFASPGQQKRESSADILTEIGRS
LKETLDTWLGPETMHVISETLLQVMWAISSAISVACFALSGIAAQLLSALGLDGEQLTQV
LKLSPSQVQTLLLWGAAALVIYWLLSLLLGLVLALLGRILGGLKLVLFVAGFVGLVRSVP
DPSTRALLLLALLTVFALLSRLTGSRSSGTHLEAKVRGLERQIEELRGRQRRAAKIPRSM
EEE
NT seq 732 nt   +upstreamnt  +downstreamnt
atggcaggcgcacacagcaatccatcatggagcaggcatctgttcaaagctgtcctaatg
gtcctaggggcccttctcctcgtccactcagcatcagcccagactcatcgagagtttgcc
tcacctggccaacagaagagggagtcctcagctgatattctgaccgagattggccgatct
ctgaaggagacgttggatacctggctggggccagagaccatgcatgtgatttcagagacc
ctgctgcaggtgatgtgggccatctcatcagccatctctgtggcctgctttgccctgtct
gggattgctgcccagttgctgagtgccctggggctggatggtgaacaactcacccaggtc
ttgaagctcagccctagccaagtccagacccttctactgtggggagcagcagcactggtc
atctactggttgctgtccctgctcctaggcttggtcttggccttgctaggacggatcctg
gggggtctgaagcttgtcctcttcgtggctggctttgtgggcctggtgaggtcggtgccc
gacccatcgacccgggccttgctgctcttggccttgctaactgtctttgccttgctgagt
cggctcaccggctccaggagctcggggacccacctagaagccaaggtgagagggctggag
cgccagatagaagagcttcgagggaggcagaggcgagcagccaagatacccaggagcatg
gaggaagaatga

DBGET integrated database retrieval system