KEGG   Rattus norvegicus (rat): 361746Help
Entry
361746            CDS       T01003                                 

Gene name
Rfx3
Definition
(RefSeq) regulatory factor X3
  KO
K09173  regulatory factor X 1/2/3
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    361746 (Rfx3)
Transcription factors [BR:rno03000]
 Eukaryotic Type
  Other basic domains
   RF-X
    361746 (Rfx3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RFX1_trans_act RFX_DNA_binding Pox_D5
Motif
Other DBs
NCBI-GeneID: 361746
NCBI-ProteinID: NP_001012172
RGD: 1307779
Ensembl: ENSRNOG00000014486
UniProt: Q5U2M9
Position
1q52
AA seq 458 aa AA seqDB search
MQTSETGSDTGSTVTLQTSVASQAAVPTQVVQQVPVQQQVQQVQTVQQVQHVYPAQVQYV
EGSDTVYTNGAIRTTTYPYTETQMYSQNTGGNYFDTQGSSAQVTTVVSSHSMVGTGGIQM
GVTGGQLISSSGGTYLIGNSMENSGHSVTHTTRASPATIEMAIETLQKSDGLSTHRSSLL
NSHLQWLLDNYETAEGVSLPRSTLYNHYLRHCQEHKLDPVNAASFGKLIRGNSKYHYYGI
RVKPDSPLNRLQEDMQYMAMRQQPMQQKQRYKPMQKVDGVADGFTGSGQQTGTSVEQTVI
AQSQHHQQFLDASRALPEFGEVEISSLPDGTTFEDIKSLQSLYREHCEAILDVVVNLQFS
LIEKLWQTFWRYSPSTPTDGTTITESRCLDPSHSKFCKKPRRLAFKCHEQYSTENDSNQG
CRCKCLCPDSAKIHIAQSPGPGSPRSASEHFPDQPDAQ
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgcagacttcagagacgggttcagacacaggttcgacagtgactctacaaacatctgtg
gctagccaagcagcagtgcctacacaagtggtacagcaggtgccagtccagcagcaggtg
cagcaggtacagacagttcagcaggtccaacatgtctacccagctcaggtgcagtatgtg
gaaggaagtgatactgtctataccaatggagcaatccgaacaacaacgtacccctacacg
gagacgcagatgtatagccaaaacactggagggaactactttgacactcaaggaagctct
gcacaggtgacgacggtggtgtcctcccacagtatggtgggtactggtggtatccagatg
ggcgtcacaggaggacaactcatcagcagctcgggaggaacctatctgattggcaattcg
atggagaattctggtcattcagtgacacacacaactcgggcctccccagcgacaattgaa
atggcgattgagacgctgcaaaagtctgacggtctgtccactcacagaagctctcttctc
aacagccatctccagtggctgttggacaattacgagacagcagaaggagtgagccttcca
aggagcaccctgtataaccactatcttcgacactgtcaggagcacaagctggacccagtc
aacgctgcctctttcggaaaactaataagaggaaactccaagtaccattactatgggatc
cgggtgaagccagattctcctcttaaccgtctacaagaagatatgcagtacatggctatg
aggcaacagcccatgcaacagaagcaaaggtacaagcctatgcagaaagtggatggggtt
gcagatggtttcacaggaagtggccaacagacaggcacatctgttgagcaaactgtaatt
gcccaaagtcaacatcatcagcagtttttagatgcatctcgagcacttccagagtttgga
gaagttgaaatctcttctttgccagatggtactacctttgaggatatcaagtcactgcag
agtctttatcgagagcactgtgaggcaatattggacgttgttgtgaatcttcagtttagc
ctgatagaaaagctgtggcaaacattctggcgctattctccctctactccaaccgacggc
actaccattacggaatcaaggtgccttgacccaagccattcgaaattttgcaaaaagcct
agaaggttggctttcaaatgccatgaacaatattccacagagaatgattcaaaccaaggt
tgccgctgtaagtgcctttgcccagactctgcgaagatacacatcgctcaatcacctggc
ccaggcagcccgcgcagtgcttcagaacacttcccagatcaaccagatgctcagtga

DBGET integrated database retrieval system