KEGG   Rattus norvegicus (rat): 361749
Entry
361749            CDS       T01003                                 

Gene name
Il33, RGD1311155
Definition
(RefSeq) interleukin 33
  KO
K12967  interleukin 33
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04217  Necroptosis
rno04623  Cytosolic DNA-sensing pathway
rno05164  Influenza A
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    361749 (Il33)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    361749 (Il33)
 09150 Organismal Systems
  09151 Immune system
   04623 Cytosolic DNA-sensing pathway
    361749 (Il33)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    361749 (Il33)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    361749 (Il33)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Interleukins
   361749 (Il33)
SSDB
Motif
Pfam: IL33 AbfB
Other DBs
NCBI-GeneID: 361749
NCBI-ProteinID: NP_001014188
RGD: 1311155
Ensembl: ENSRNOG00000016456
UniProt: Q66H70
Position
1q52
AA seq 264 aa
MRPRMKYSNSKISPAKCDSTSGRALVPPCKITRSQQKTKDICHVYCMRLRSGLTIRKETC
YFGKEPAKRYSLKSGSKHEGRLSTCLPDSRKRSLLGSIQAFAASVDTLSIQGTSLLTESC
ALSTYNDQSVSFVLENGCYVINVEDCGKNQEKDKVLLRYYESSFPAQSGDGVDGKKLMVN
MSPIKDTDIWLNANDKDYSVELQKGDVSPPDQAFFVLHKKSSDFVSFECKNLPGTYIGVK
DNQLALVEENDESCNNIMFKLSKM
NT seq 795 nt   +upstreamnt  +downstreamnt
atgagacctagaatgaagtattcgaactccaagatttccccggcaaagtgcgacagcaca
tcaggcagagccctggtcccgccttgcaaaatcacaagatcccaacagaagaccaaagat
atctgccatgtctactgcatgaggctccgttctggcctcaccataagaaaggagacctgt
tattttggaaaagaacccgccaaaagatattcactaaaatcaggtagcaagcatgaaggg
aggctctctacctgtttaccagattctaggaagagatccctgcttggcagtatccaagcg
tttgctgcatcagttgacacactgagtatccaaggaacttcactgctaacagaatcttgt
gccctgagcacatacaacgaccaatctgttagttttgttttggagaatggatgttacgtg
atcaatgttgaagattgtgggaaaaaccaagaaaaagataaggtgctactccgttactac
gagtcttcctttcctgcacaatcaggagacggtgtggatgggaagaagctgatggtgaac
atgagtcctatcaaagacacagacatctggctgaatgccaatgacaaggactactctgtg
gagctccaaaagggtgatgtctctccgccagatcaggccttctttgttcttcacaaaaag
tcctctgacttcgtttcattcgaatgcaagaatcttcctggcacttacataggagtaaaa
gacaaccaactggctctggtagaagagaatgatgagagctgtaacaatatcatgtttaag
ctctctaagatgtaa

DBGET integrated database retrieval system