KEGG   Rattus norvegicus (rat): 361752
Entry
361752            CDS       T01003                                 

Gene name
Pde6c
Definition
(RefSeq) phosphodiesterase 6C
  KO
K13757  cone cGMP-specific 3',5'-cyclic phosphodiesterase subunit alpha' [EC:3.1.4.35]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00230  Purine metabolism
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    361752 (Pde6c)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.35  3',5'-cyclic-GMP phosphodiesterase
     361752 (Pde6c)
SSDB
Motif
Pfam: PDEase_I GAF GAF_2 GAF_3 SpoVT_C
Other DBs
NCBI-GeneID: 361752
NCBI-ProteinID: NP_001101992
RGD: 1309844
Ensembl: ENSRNOG00000016593
UniProt: D3ZLC7
Position
1q53
AA seq 861 aa
MGEISQDAVERYLEENPCFAKEYFDKKLRVETPGAIFKNSHAGVQAGTSLPRMTQVEESA
LCLELLQHMQDETGSAEQVAHRALQRLARLLQAECCSMFSCRSRNGIPEVASRLLNVTPT
SKFEDNLVAPNREVVFPLDIGIVGWVAHVKKALNVSNVKKNSHFSDFMDKQTGYVTRNLL
AVPIMTGKEVLAVVMAVNKINAPEFSKQDEEVFSKYLSFVAIALRLQHTSYLYSVESRRS
QILMWSANKVFEELTDVERQFHKALYTVRTYLNCERYSIGLLDMTKEKEFYDEWPIKLGE
VEPYKGPKTPDGREIIFYKIIDYILHGKEEISVIPSPPADHWTLVSGLPTYIAENGFICN
MMNAPADEYFTFQKGPVDETGWVIKNVLSLPIVNKKEDIVGVATFYNRKDGKPFDEHDEH
ITETLTQFLGWSLLNTDTYERVNKLESRKDIAQEMIMNLTKATPSEISSILKFKEKLNID
VIEECEERQLLAILKEELPDPRAADLYEFRFSDFPVTEHELVKCGLRLFLEINVVEKFKV
PVEVLTRWMYTVRKGYRPVTYHNWRHGFNVGQTMFTLLMTGRLKKYYTDLEAFAMLAAAF
CHDIDHRGTNNLYQMKSTSPLARLHGTSILERHHLEYSKTLLQDESLNIFQNLSKRQFET
VIHLFEVAIIATDLALYFKKRTMFQKIVDTCEQMQSEEETIKYVTADPTKKEVIMAMMMT
ACDLSAITKPWEVQSQATLLVANEFWEQGDLERTVLQQQPIPMMDRNKKGELPKLQVGFI
DFVCTFVYKEFSRFHGEITPMLTGLQNNRVEWKSLAEEYEAKVKVTEEEVGKQEEVTSDG
KAATDLGSSTDDKKSKTCLML
NT seq 2586 nt   +upstreamnt  +downstreamnt
atgggggagatcagccaagatgccgtggagcgctacctggaggagaacccttgttttgcc
aaggagtactttgacaagaagctgcgggtggagacaccgggggcgatcttcaaaaacagc
catgcgggggtccaggctggcacgtctctcccccggatgacacaggtggaggagtcggcc
ttgtgcctggagctactacagcatatgcaggacgagacaggaagcgccgagcaggtggct
cacagggccctgcagaggctggctcggcttctacaggctgaatgctgcagtatgttctca
tgccgatcaagaaacggcataccggaggtggcctccaggctgctgaacgtcaccccaact
tctaagtttgaggacaacctcgtggcccctaacagagaagttgtatttccgttggacatt
gggatagttggctgggtcgctcatgtgaagaaagcccttaatgtctcaaatgtcaaaaag
aacagccatttttctgactttatggacaagcaaactggatatgtcaccaggaatctgctg
gcagtccccatcatgacgggcaaggaggttcttgctgtggtcatggcagtgaacaaaatc
aacgctcccgagttttccaaacaggatgaggaggtcttttccaagtacctcagctttgtt
gcgatcgctctaaggctgcagcacaccagttacctgtacagtgtggagtcccggagaagc
cagatccttatgtggtcagccaataaagtattcgaggagctcactgacgttgagcgacag
tttcacaaggccctgtacaccgtcagaacatacctgaactgcgagcgctactccattggt
cttctggacatgaccaaggagaaggaattttacgacgagtggccaatcaagcttggagaa
gttgaaccttataaaggaccaaagactccagatggcagggaaatcatcttttataaaatc
atcgattacattttacatggaaaagaagagatcagcgtgattccgtcacctccagcagat
cactggacactcgttagtggattgccaacatacattgctgaaaatggatttatctgtaac
atgatgaacgcccctgcagatgagtacttcacattccagaaaggaccagtggacgaaact
ggctgggtcattaaaaatgtcttgtccctgcctattgtcaacaagaaagaagacatcgtg
ggtgtggctacgttttacaaccggaaggatgggaaaccctttgatgagcatgacgaacac
atcactgagactttaacccagtttcttggatggtctcttttaaacaccgatacctatgag
cgagtgaacaagctggaaagccgaaaggacattgctcaggaaatgattatgaacctcacc
aaagccacccctagtgaaatcagctctattttgaaatttaaagagaagttaaacatagat
gtaattgaagaatgtgaggagagacagctcctggccatattgaaggaggagctgcccgac
ccaagagcagcagacctgtacgagttccgtttcagcgacttccccgttacggagcacgag
ttggttaaatgcgggctgcggctgtttttggagataaatgtggtggagaaattcaaagta
ccggtcgaggttcttacacggtggatgtacacagttcggaaagggtaccgccctgtcacc
taccacaactggcgacacggattcaacgtggggcagaccatgttcactttgttaatgact
gggagactaaagaaatactacacagacctcgaagcttttgccatgcttgctgctgccttc
tgccatgacattgaccacagaggaaccaataacttgtaccaaatgaagtccacatctcca
ctggcaaggcttcatgggacttccattttagagcgacatcacctggaatatagcaagact
ctcttgcaggatgagagtttaaacatcttccagaatctaagcaagcggcagtttgaaacg
gtgatccacttgtttgaggttgcgataatagcaactgacctggcactctatttcaagaag
agaaccatgtttcaaaagattgttgatacctgtgaacagatgcaaagcgaagaagaaacc
atcaaatatgtaaccgccgacccgaccaaaaaggaggtcatcatggccatgatgatgact
gcctgcgacctgtctgccatcaccaagccctgggaggtgcagagtcaggcaacacttctg
gttgcaaatgaattttgggaacaaggagatctggaaaggacagtgcttcagcagcaacca
attcctatgatggacagaaacaaaaagggtgaactcccaaaacttcaagtgggattcatt
gattttgtttgtacttttgtatataaggagttctctcgctttcacggggagatcaccccc
atgctgaccggccttcagaataacagagtggaatggaaatcactggcggaggagtatgag
gcgaaggtgaaggtgactgaagaggaggtgggaaagcaggaagaagttacctcagatgga
aaagctgccacagatttaggaagcagcacagatgacaaaaagtccaaaacgtgcttaatg
ttataa

DBGET integrated database retrieval system