KEGG   Rattus norvegicus (rat): 361764
Entry
361764            CDS       T01003                                 

Gene name
Sema4g
Definition
(RefSeq) semaphorin 4G
  KO
K06521  semaphorin 4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    361764 (Sema4g)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:rno04090]
    361764 (Sema4g)
CD molecules [BR:rno04090]
 Proteins
  361764 (Sema4g)
SSDB
Motif
Pfam: Sema PSI Ig_2 Ig_3 ig Trp_oprn_chp PSI_integrin
Other DBs
NCBI-GeneID: 361764
NCBI-ProteinID: NP_001101996
RGD: 1310436
Ensembl: ENSRNOG00000014650
UniProt: D4A6G2
Position
1q54
AA seq 837 aa
MWGRLWPLLFSFLTATAVPGPSLRRPSRELDATPRMTISYEELSWIRHFKGQAQNYSTLL
LEEASQRLLVGARGALFSLSARDIGDGTHKEIHWEASPEMQSKCHQKGKNNQTECFNHVR
FLQRLNASHFYACGTHAFQPLCAAIDAEAFILPTSFEEGKEKCPYDPARGFTGLIIDGGL
YTATRYEFRSIPDIRRSRHPHSLRTEEAPMHWLNDAEFVFSVLVRESKTSVVGDDDKIYY
FFMEREEGSSSFTQSRSSHRVARVARVCKGDLGGKKILQKKWTSFLKARLICHIPQYETL
RGVCSLDADTSSHTHFYAVFTLTTQWKTLEASAICRYDLAEIQAVFTGPFMEYQDGARRW
GRYEGGVPEPRPGSCITDSLRSRGYNSSQDLPSLVLDFVKLHPLMARPVVPTRGRPLLLK
RNVRYTHLTGTHVSIPAGPTYDLLFLGTADGWIHKAVVLGSGMHIIEEIQVFRESQSVDN
LVISPMQHSLYVGAASGVIQFPLSSCSRYRSCYDCILARDPYCGWDSSTHACMVATTIAN
RTALIQDIERGNRGCEGSRDAGPPPPFKTRSVLRGDDVLLPCDQPSNLARALWLLNGSKS
LSDGQDGYRVGVDGLLVTDTQLEHSGNYGCYAEENGLRMLLASYSLIVRPATPAPAPQAP
ATPGAQLAHDMRLFYVVAIAILGGLCLILASSLLYVACLRGGRRGRRRKYSLGRAGRAGG
SAVQLQTVSGQCPGEEDDGDDGEGAGSLESGCLQIIPGEGAPAPPPPPPPPPPAELTNGL
VALPSRLRRMNGNSYVLLRQSNNGVPAGPCSFAEELSRILEKRKHTQLVEQLDESSV
NT seq 2514 nt   +upstreamnt  +downstreamnt
atgtgggggaggctctggcccctcctcttcagcttcctcacagcaacagcagtgcctgga
ccctcactgcggagaccatcccgagagctagatgccaccccacggatgaccatctcctat
gaagagctctcctggatcaggcacttcaagggccaagcccagaactattcaacactgctg
ctggaggaggcttcccaaaggctgttggtgggagctcgaggtgccctgttctctctcagt
gcccgtgacataggagatgggactcacaaagagatccactgggaggcctccccagagatg
caaagcaagtgtcatcagaaagggaaaaacaaccagacggagtgtttcaaccatgtgcga
tttctacagcggctcaatgcctcccacttctatgcatgtgggacccacgccttccagccc
ctctgtgcagccattgatgctgaggccttcatcttgcctactagcttcgaggagggaaag
gagaaatgtccttacgacccagcccgtggcttcacgggccttatcattgatggaggcctc
tacacagccacgcggtatgaattccggagcattcctgatatccgccggagccgccaccca
cactctctgagaaccgaggaggcacccatgcactggctcaatgatgctgagtttgtgttc
tctgtgctggtgcgggagagcaagaccagtgtagtgggtgacgatgacaagatttactac
ttcttcatggagcgtgaggaaggttccagcagcttcactcagagtcgcagcagccaccgt
gtggctagagtagcccgtgtgtgcaagggagatctgggagggaagaagatcctacagaag
aagtggacatccttcctgaaggctcgcctcatctgccacatcccacagtatgagacactt
cgtggggtctgcagcctggatgctgatacgtcatcccacacacacttctatgcagtcttc
acactgacgacacagtggaagactctggaggcttcagccatctgccgctatgacctggct
gagattcaggctgtcttcacaggcccttttatggagtaccaggatggtgcccggcgctgg
ggccgctacgagggtggagtccctgaacccaggcctggctcgtgcatcacagattcattg
cgcagccgaggctacaactcatctcaagacttgccatccctcgttctggactttgtgaag
ttgcacccactgatggctcggcctgtggtacccacacgtgggcggcccctgctgctgaag
cgcaatgtacgctacacacatctcacaggaacacacgtcagcatacctgctggacccacc
tatgacctgctctttctaggcacagctgatggctggatccacaaggccgtagtcctgggc
tctgggatgcacattatcgaagagatacaagtgttcagggagtcccagtctgtggacaat
ctagttatctcaccgatgcagcacagcctctatgtgggggctgcgagtggagtcatccag
tttcctctgtccagttgctcacgctaccgttcctgctatgactgcatcctggcacgggac
ccctactgtggctgggactccagcacccatgcctgcatggtggccaccaccatagccaac
aggacagcattgatacaggacatagagagaggaaatcgaggctgtgagggcagcagggat
gcaggaccaccaccgccattcaagacccgatctgtgctccggggtgatgatgtcctcttg
ccctgtgaccagccatctaacctggcccgggctttgtggctcctcaacgggagcaagagc
ctgagtgatgggcaggatggctaccgcgtgggagtggatgggctgctggtaacagacaca
caactggagcatagtggcaactatggctgctatgctgaggagaacggcctccgtatgctg
ctggcttcctacagcctcatagtccggccagccacccctgccccagctccacaagcccct
gccacacctggggcacagctggcacatgacatgagattgttctatgtggtagccattgct
atacttggtggcctctgccttatcttggcatcttccctcctctatgtggcttgtctgcgg
ggaggcagacgaggtcgaagacgaaaatactcattgggtcgggctggccgggcagggggc
tcagccgtgcagctgcagactgtctcaggccagtgtcccggagaggaagatgacggtgat
gatggagaaggcgctggcagtctggagagtggctgcctccagatcatccctggggaagga
gccccagccccaccacccccaccacctccacccccacctgctgagctgaccaatggactg
gtggccctgcccagccggctgcgaaggatgaatggcaacagttacgtgctcctgaggcag
agcaacaatggagtgccagcaggtccctgctcctttgcagaggagctcagccgcatcctg
gagaagaggaagcacacgcagcttgtagagcagctagatgagagctctgtttga

DBGET integrated database retrieval system