KEGG   Rattus norvegicus (rat): 361769
Entry
361769            CDS       T01003                                 

Gene name
Sufu
Definition
(RefSeq) SUFU negative regulator of hedgehog signaling
  KO
K06229  suppressor of fused
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04340  Hedgehog signaling pathway
rno05200  Pathways in cancer
rno05217  Basal cell carcinoma
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    361769 (Sufu)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    361769 (Sufu)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    361769 (Sufu)
SSDB
Motif
Pfam: SUFU_C SUFU
Other DBs
NCBI-GeneID: 361769
NCBI-ProteinID: NP_001020070
RGD: 1559462
Ensembl: ENSRNOG00000019807
UniProt: Q4V8C6
Position
1q54
AA seq 485 aa
MAELRPSVAPGPAAPPASGPSAPPAFASLFPPGLHAIYGECRRLYPDQPNPLQVTAIVKY
WLGGPDPLDYVSMYRNMGSPSANIPEHWHYISFGLSDLYGDNRVHEFTGTDGPSGFGFEL
TFRLKRETGESAPPTWPAELMQGLARYVFQSENTFCSGDHVSWHSPLDNSESRIQHMLLT
EDPQMQPVQTPFGVVTFLQIVGVCTEELHSAQQWNGQGILELLRTVPIAGGPWLITDMRR
GETIFEIDPHLQQERVDKGIETDGSNLSGVSAKCAWDDLSRPPEDDEDSRSICLGTQPRR
LSGKDTEQIRETLRRGLEINSKPVLPPINSQRQNGLTYDRAPSRKDSLGSDISTAVIPHE
LIRTRQLESVHLKFNQESGALIPLCLRGRLLHGRHFTYKSITGDMAITFVSTGVEGAFAT
EEHPYAAHGPWLQILLTEEFVEKMLEDLEDLTSPEEFKLPKEYSWPEKKLKVSILPDVVF
DSPLH
NT seq 1458 nt   +upstreamnt  +downstreamnt
atggcggagctgaggcctagcgtcgcccccggccccgccgcgcccccggcctctggccct
agtgcccccccggcctttgcttcactctttcccccgggactccacgccatctacggagag
tgccgccgcctctaccctgaccagccgaacccgctccaggttaccgctatcgtcaagtac
tggttgggtggtccagaccccttggattatgtaagcatgtacaggaatatggggagtcct
tctgccaacatccctgagcactggcactacatcagctttggcctgagtgatctctacggt
gacaacagagtccacgagtttacaggaacagacggaccaagtggatttggctttgaattg
acatttcgtctgaagagagaaactggggagtctgccccaccaacatggccagcagagctg
atgcagggcctagcccgatatgtcttccagtcagagaataccttctgtagtggggaccac
gtgtcttggcacagccctttggataacagtgagtcaagaattcagcacatgctgctgacg
gaggacccacagatgcagcctgtgcagacaccctttggggtagttactttcctccagatt
gttggtgtctgcactgaggagttacactcagcccagcagtggaatgggcagggcatcctg
gagctgctgcggacagtgcccattgctggcggtccctggctgataactgacatgcggagg
ggagaaaccatattcgagatcgatccacacctgcaacaggagagagttgacaaaggcatc
gagacagacggttctaacctgagcggtgtcagtgccaagtgtgcctgggatgacctcagc
cggcctccggaggacgatgaggatagccggagcatctgcctcggcacgcagcctcgaagg
ctgtctggcaaagacacagagcagatccgggagaccctgaggcgaggactggagattaac
agcaaacctgtccttccaccaatcaattctcaaaggcagaatggcctcacctacgaccga
gccccgagccgtaaggacagcttgggcagtgacatctccacggctgttatcccccacgag
ctgatccgcacacggcagctcgaaagcgtgcatctgaaatttaaccaggagtcgggagcc
ctcatccccctctgcctaaggggcagactcctgcatggccggcacttcacctacaagagt
atcacaggtgacatggccatcacgtttgtgtccaccggagtggaaggcgcctttgccact
gaggaacatccttacgcagctcacggaccctggttacaaattctgttgacagaagagttt
gtagagaaaatgttggaggacttagaagatctaacttctccagaggaatttaaacttccc
aaagagtacagctggcctgaaaagaagctcaaagtgtccatcctccccgacgtggtgttc
gacagtccgctgcactag

DBGET integrated database retrieval system