KEGG   Rattus norvegicus (rat): 361795
Entry
361795            CDS       T01003                                 

Gene name
Ltb
Definition
(RefSeq) lymphotoxin beta
  KO
K03157  lymphotoxin beta (TNF superfamily, member 3)
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04064  NF-kappa B signaling pathway
rno05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    361795 (Ltb)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    361795 (Ltb)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    361795 (Ltb)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    361795 (Ltb)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Tumor necrosis fators
   361795 (Ltb)
SSDB
Motif
Pfam: TNF
Other DBs
NCBI-GeneID: 361795
NCBI-ProteinID: NP_997672
RGD: 1303162
Ensembl: ENSRNOG00000058566
UniProt: Q6MG45
Position
20p12
AA seq 306 aa
MGTRGLQGLGGRPQGRGCLLLAVAGATSLVTLLLAVPITVLAVLALVPQDQGRQVEKIVI
GSGAQAQKGLDNKPSCISPSPSSLSETPDPRLHPQRSYSSRNLDPTSQRPVAQPSREASA
WVTTLSPAVDSILDPGVQQLPLGEPETDFSPELPAAHLIGAWMSGQGLSWEASQEEAFLR
SGAQFSRTHGLALPQDGVYYLYCHVGYRGRTPPAGRSRARLFTLRSALYRAGGAYGRGSP
ELLLEGAETVTPVVDPIGYGSLWYTSVGFGGLAQLRSGERIYVNISHPDMVDYRRGKTFF
GAVMVG
NT seq 921 nt   +upstreamnt  +downstreamnt
atggggacacggggactgcagggcctgggtgggaggccccaggggaggggctgcctcttg
ctggctgtggcaggagctacatcgctggtgaccctgctgttggcagtgcctatcactgtc
ctggctgtgctggccctggtgccccaggatcagggacgtcaggttgagaagatcgttatt
ggctcgggagcacaggctcaaaaaggactggacaacaaaccctcgtgcatctcgccctca
ccctctagcctctcagagactcccgatccccgtctgcatcctcagagatcctattcttcc
aggaatctagatcccacatcccagcgccctgttgcacagccctctcgggaggcatctgca
tgggtgaccaccctgtccccagctgtggattctatactagatccaggggttcaacagctg
ccattgggggaaccagaaactgacttcagccccgagcttcctgctgcccacctcataggc
gcttggatgagcgggcaagggctcagctgggaggcgagccaagaagaagcgtttctgaga
agcggtgcgcagttctcccgcacccatgggctggcgctgcctcaggacggcgtctactat
ctctactgccatgtcgggtatcggggccggacgccccctgccggccgaagccgcgctcgc
ttgttcacgctgcgcagcgccctgtaccgcgcggggggcgcctatgggcggggctccccc
gagctgctgctggagggcgcggagaccgtgacccctgttgtggatcccatcgggtacggg
tctttgtggtacacgagcgtggggttcggcggcctggcgcagctccggagcggcgagagg
atatacgtcaacatcagtcatcccgacatggtggactacaggagagggaagaccttcttc
ggggcggtgatggtggggtga

DBGET integrated database retrieval system