KEGG   Rattus norvegicus (rat): 361798Help
Entry
361798            CDS       T01003                                 

Gene name
Ehmt2, Bat8, G9a, Ng36
Definition
(RefSeq) euchromatic histone lysine methyltransferase 2
  KO
K11420  euchromatic histone-lysine N-methyltransferase [EC:2.1.1.43]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00310  Lysine degradation
rno04211  Longevity regulating pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    361798 (Ehmt2)
 09150 Organismal Systems
  09149 Aging
   04211 Longevity regulating pathway
    361798 (Ehmt2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    361798 (Ehmt2)
Enzymes [BR:rno01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     361798 (Ehmt2)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     361798 (Ehmt2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_2 Ank Ank_4 Ank_5 SET Ank_3 Pre-SET CDC45 RNA_pol_3_Rpc31 Nop14 Paf1 XRCC4 Nop53
Motif
Other DBs
NCBI-GeneID: 361798
NCBI-ProteinID: NP_997628
RGD: 1302972
Ensembl: ENSRNOG00000030630
Vega: OTTRNOG00000001718
UniProt: Q6MG72
Position
20p12
AA seq 1263 aa AA seqDB search
MRGLPRGRGLMRARGRGRAAPTGGRGRGRGGAHRGRGRPRSLLSLPRAQASWAPQLPAGL
TGPPVPCLPSQGEAPAEMGALLLEKEPRGAAERVHGSLGDTSHSEETLPKANPDSLEPTG
PSSPASVTVTVGDEGADTPVGATPLIGEEPENLEGDGGRILLGHATKSFPSSPSKGGACP
SRAKMSMTGAGKSPPSVQSLAMRLLSMPGAQGAATAGPEPPPATTAGQEGQPKVHRARKT
MSKPSNGQPPVPEKRPPEVQHFRMSDDMHLGKVTSDVAKRRKLTSGSLSEDLGSAGGSGE
VILEKGEPRPLEEWETVVGDDFSLYYDAYSVDERVDSDSKSEVEALAEQLSEEEEEEEEE
EEEEEEEEEEEEEEEEDEESGNQSDRSGSSGRRKAKKKWRKDSPWVKPSRKRRKREPPRA
KEPRGVNGVGSSGPSEYMEVPLGSLELPSEGTLSPNHAGVSNDTSSLETERGFEELPLCS
CRMEAPKIDRISERAGHKCMATESVDGELLGCNAAILKRETMRPSSRVALMVLCEAHRAR
MVKHHCCPGCGYFCTAGTFLECHPDFRVAHRFHKACVSQLNGMVFCPHCGEDASEAQEVT
IPRGDGGTPPVGTVAPAPPPLAHDAPGRADTSQPSARMRGHGEPRRPPCDPLADTIDSSG
PSLTLPNGGCLSAVGLPPGPGREALEKALVIQESERRKKLRFHPRQLYLSVKQGELQKVI
LMLLDNLDPNFQSDQQSKRTPLHAAAQKGSVEICHVLLQAGANINAVDKQQRTPLMEAVV
NNHLEVARYMVQLGGCVYSKEEDGSTCLHHAAKIGNLEMVSLLLSTGQVDVNAQDSGGWT
PIIWAAEHKHIDVIRMLLTRGADVTLTDNEENICLHWASFTGSAAIAEVLLNAQCDLHAV
NYHGDTPLHIAARESYHDCVLLFLSRGANPELRNKEGDTAWDLTPERSDVWFALQLNRKL
RLGVGNRAVRTEKIICRDVARGYENVPIPCVNGVDGEPCPEDYKYISENCETSTMNIDRN
ITHLQHCTCVDDCSSSNCLCGQLSIRCWYDKDGRLLQEFNKIEPPLIFECNQACSCWRSC
KNRVVQSGIKVRLQLYRTAKMGWGVRALQTIPQGTFICEYVGELISDAEADVREDDSYLF
DLDNKDGEVYCIDARYYGNISRFINHLCDPNIIPVRVFMLHQDLRFPRIAFFSSRDIRTG
EELGFDYGDRFWDIKSKYFTCQCGSEKCKHSAEAIALEQSRLARLDPHPELLPDLSSLPP
INT
NT seq 3792 nt NT seq  +upstreamnt  +downstreamnt
atgcggggtctgccgagagggagggggctgatgcgggcccgggggcgggggcgtgcggcc
cccacgggcggccgcggccggggtcgcgggggcgcccaccgtggacgaggtaggccccga
agcctgctctcgctgcccagggcccaggcgtcttgggccccccagctgcctgccgggctg
accggccctccggtcccttgtctcccctcccagggggaggcccccgctgagatgggggcg
ctgctgctggagaaggagccccgaggagccgccgagagagttcatggctctttgggggac
acctctcatagtgaggagacccttcccaaggccaaccccgactccttggagcctaccggc
ccctcctctccggcctctgtcactgtcaccgtcggcgatgagggggctgacacccctgtc
ggggccacaccgctcatcggggaggaacccgagaacctggagggagatgggggtcgaatc
ctgctgggccatgccacaaagtcattcccctcttcccccagcaaggggggtgcctgtccc
agtcgggccaaaatgtcaatgacaggggcaggaaagtcgcccccctcggtccagagtttg
gccatgaggctgttgagcatgcctggggcccagggagctgcaactgctgggcctgagccc
cctccggcaacaactgccggccaggaggggcagcccaaagtacaccgagctcggaaaacc
atgtccaagcctagcaacggacagcctccagtccctgagaagcggccccctgaagtccag
catttccgcatgagtgacgacatgcatctgggaaaggtgacttcagatgtggccaaacgg
aggaagttgacctcgggcagcctgtcagaggacttgggctctgctgggggctcaggagaa
gtgatcctggagaagggagagcccaggcctctggaggagtgggagacggtggtgggcgat
gacttcagcctgtactatgacgcgtactctgtggatgagcgggtggactctgacagcaag
tctgaagtcgaagctctagctgaacagttgagtgaagaggaggaggaggaagaggaggaa
gaagaagaggaagaggaggaagaggaggaggaggaagaggaggaggaggatgaggagtcg
ggcaaccagtcagacaggagtggctctagcggccgacgcaaggccaagaagaaatggcgg
aaagacagcccatgggtgaagccatccaggaaacggcggaagcgagagcctccgagggcc
aaggagcccagaggagtgaatggtgtgggttcctcagggcccagtgagtacatggaggtt
cctctggggtccctggagctgcccagcgaggggaccctctcccccaaccacgctggggtc
tccaatgacacgtcttcgctggagacggagcgtgggtttgaggagctgcccctctgcagc
tgccgcatggaggcgcccaagattgaccgcatcagcgagagagcaggacacaagtgtatg
gccaccgaaagtgtggacggagagctgctgggttgcaatgccgccatcttgaagcgggag
accatgcggccgtctagccgtgtggcgctgatggtactgtgtgaggcccatcgagcccgc
atggtcaagcaccattgctgcccaggctgtggctacttctgcacggcgggcaccttcctg
gagtgtcaccccgacttccgtgtagctcaccgcttccataaggcctgcgtgtcccagctc
aatgggatggttttctgtccccactgtggggaggacgcctcagaggcccaggaggtgacc
atccctcggggcgatgggggaacacccccggttggcactgtggcgcctgccccgccaccc
ctggcacacgacgccccagggcgagcggatacctcccagcccagtgcccgaatgcgagga
cacggagagccaaggcgcccaccctgtgatcccctggccgacaccattgacagctcgggg
ccttctctgactctgcctaatggcggctgcctctcagctgtgggtctgcccccagggcca
ggccgggaagccctggaaaaagccttggtcatccaggagtccgagaggaggaagaagctg
cggttccacccgcggcagctctacctgtcggtgaagcagggggagctgcagaaggtgatc
ctcatgctgctcgacaacctggaccccaacttccagagcgaccagcagagcaagcgcacg
cccctgcacgcagccgcccagaaggggtccgtggagatctgtcacgtgctgctacaggca
ggagccaacatcaacgccgtggataagcagcagcgcaccccgctgatggaggccgtggtg
aacaaccacctggaggtggctcgctacatggtgcagctgggcggctgtgtgtacagcaag
gaagaggatggctctacctgtctccatcatgcggccaaaattgggaacttggaaatggtc
agcctgctgctgagcacagggcaggtggacgtcaatgcccaggacagtgggggctggaca
cccatcatctgggcagccgagcacaagcacatcgacgtgatccgtatgctgctgacccgg
ggcgccgacgtcacccttaccgacaacgaggaaaacatctgcctgcactgggcttccttc
acgggtagtgccgctattgccgaggtcctcctgaatgcccagtgcgacctccatgctgtc
aactaccacggggacacgcccctgcacatagccgccagggagagctaccatgactgcgtt
ctgttgttcctgtcccgtggagccaaccctgagcttcggaacaaagaaggggacacggcg
tgggatctgaccccagagcgctccgatgtgtggtttgcactgcagctcaatcgcaagctt
aggctcggggtagggaaccgggctgtccgcaccgagaagatcatctgccgggatgtagcc
cgaggctatgagaatgtgcccattccctgtgtcaatggcgtggatggggagccatgccca
gaggactataagtacatctccgagaactgtgaaacgtccaccatgaacatcgaccgaaac
atcactcacctgcagcactgcacgtgtgttgacgactgctccagctccaactgcctgtgt
ggccagctaagcatccgatgctggtatgataaggacgggcggctgctccaggagtttaac
aagatcgagccccccctgatctttgagtgtaaccaggcatgctcctgctggagaagctgc
aagaaccgcgtggtgcagagcggcatcaaggtgcggctgcagctctaccggacggccaag
atgggctggggggtccgtgccttgcagaccattccccagggcacgttcatctgcgagtac
gtcggggagctgatctccgacgccgaggcagacgtgagagaggatgattcttacctcttc
gacttagacaacaaggatggtgaggtctactgcattgatgcccgttactatggcaacatc
agccgcttcattaaccacctgtgcgaccccaacatcatccctgttcgggtcttcatgctg
catcaagacctacggttccctcgcatcgccttcttcagctccagggacatccggaccggg
gaggagctggggtttgactacggcgaccggttctgggatatcaagagcaagtatttcacc
tgccagtgtggctctgagaagtgcaagcattcagctgaggccatcgccctggagcagagc
cgcctggcccgtctggacccccacccggagctgctccctgacctcagctccctgcccccc
atcaacacctga

DBGET integrated database retrieval system