KEGG   Rattus norvegicus (rat): 361811Help
Entry
361811            CDS       T01003                                 

Gene name
Srpk1
Definition
(RefSeq) SRSF protein kinase 1
  KO
K15409  serine/threonine-protein kinase SRPK1 [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    361811 (Srpk1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    361811 (Srpk1)
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:rno03041]
    361811 (Srpk1)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     361811 (Srpk1)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: CMGC group
  SRPK family [OT]
   361811 (Srpk1)
Spliceosome [BR:rno03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    361811 (Srpk1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr
Motif
Other DBs
NCBI-GeneID: 361811
NCBI-ProteinID: NP_001020897
RGD: 1308272
Ensembl: ENSRNOG00000000511
Vega: OTTRNOG00000001968
UniProt: Q4KLN3
Position
20p12
AA seq 655 aa AA seqDB search
MERKVLALQARKKRTKAKKDKAQRKPETQHRGSAPHSESDIPEQEEEILGSDDDEQEDPN
DYCKGGYHLVKIGDLFNGRYHVIRKLGWGHFSTVWLSWDIQGKKFVAMKVVKSAEHYTET
ALDEIRLLKSVRNSDPNDPNGEMVVQLLDDFKISGVNGTHICMVFEVLGHHLLKWIIKSN
YQGLPLPCVKKIIQQVLQGLDYLHTKCRIIHTDIKPENILLSVNEQYIRRLAAEATEWQR
SGAPPPSGSAVSTAPQPKPADKMSKNKKKKLKKKQKRQAELLEKRMQEIEEMEKESGPGQ
KRPNKQEESESPVERPLTENPPNKMTQEKLEESSSIGQDQTLTEHGGEGGAPEINCNGVI
GIVNYTANSNNETLRLKEDLHNANDCDGRTLKQEPSFLSSPNGDSSPSPETDSCTPSGSE
VPETMACQASVERSLTLTQQDITHLQERIRAHTPSGDEQEREHNGALDSKGKFSAGNFLI
NPLEPKNAEKLKVKIADLGNACWVHKHFTEDIQTRQYRSLEVLIGSGYNTPADIWSTACM
AFELATGDYLFEPHSGEDYTRDEDHIALIIELLGKVPRKLIVAGKYSKEFFTKKGDLKHI
TKLKPWGLLEVLVEKYEWPQEEAAGFTDFLLPMLELMPEKRATAAECLRHPWLNS
NT seq 1968 nt NT seq  +upstreamnt  +downstreamnt
atggagcggaaagtgctcgcgctccaggcccgaaagaaaaggaccaaggccaagaaggac
aaagcccaaaggaagcctgaaacccagcaccgaggctctgcaccccactccgagagcgac
atccccgagcaggaggaggagattctggggtctgatgatgatgaacaggaagaccctaac
gactactgtaaaggaggttatcatcttgtgaaaattggagatctatttaacgggcgatac
catgtgattcgaaaattaggctggggacacttttccacagtatggttatcatgggatatt
cagggaaagaagtttgtagcaatgaaagtagttaaaagtgccgaacattacacagagaca
gcactggatgagatccggctcctgaaatcggttcgcaattcagacccgaatgatccaaat
ggagaaatggtcgttcaactactagatgactttaaaatatcaggcgttaatggaacacat
atctgcatggtgtttgaagttttaggacatcatctactcaagtggatcatcaagtccaac
tatcaggggcttccgctgccttgtgtcaaaaaaattattcagcaagtgctccagggtctg
gattacttacacaccaagtgccggatcatccacactgacatcaagccggaaaacatcctg
ttgtccgtgaacgagcagtacattcggaggctggctgcagaggccacagagtggcaacgg
tctggagctcccccaccatcggggtctgcagtcagcactgctccacagcctaagccagct
gacaaaatgtcaaagaataagaagaagaaattgaagaagaagcagaagcgccaggcagaa
ttactagagaagcgaatgcaggaaattgaggaaatggagaaagagtcgggccctgggcaa
aaaagacctaacaagcaagaagaatcagagagtcctgttgaaagacccttgacagagaac
ccacctaataaaatgacccaagagaaacttgaagagtcgagttccattggccaggatcag
acactcacggagcatggtggagagggtggtgcgccagaaattaattgcaatggagtgatt
ggaatcgttaattacactgcaaacagtaacaatgaaaccttgaggcttaaagaggaccta
cataatgccaatgactgtgatggccgcactctgaagcaggaacctagcttcctaagctct
ccaaatggagacagtagtccgtctccagaaacagactcttgcacaccttcgggctcggag
gtgcccgagaccatggcgtgccaggcctctgtagagcggtcactcaccctcacccaacag
gacatcacccacctgcaggagcgcatccgggcacatacgccttctggggatgagcaggag
cgggaacacaatggagcgctggacagcaaaggaaaattctctgctggaaattttcttatt
aatcccctggagccaaaaaatgcagaaaagctcaaagtgaagattgctgatcttgggaat
gcctgctgggtgcacaagcatttcaccgaagacatccagacccggcagtaccggtctttg
gaggtcctgataggatctggctacaacacccctgctgacatctggagcacagcatgcatg
gcctttgaactagccacaggggactatctgtttgagcctcattcgggggaggattacacg
cgagatgaagaccacatcgccctgatcatagagctcctggggaaggtgcctcgcaagctc
attgtagcagggaaatactccaaggaatttttcaccaaaaaaggtgacctgaaacacatc
accaagttgaagccttggggtcttctggaggttctggtggagaagtatgagtggcctcag
gaggaggctgctggcttcacagatttcctgctgcccatgttggagctcatgcctgagaag
agagccactgccgctgagtgtctccggcatccttggctgaactcctaa

DBGET integrated database retrieval system