KEGG   Rattus norvegicus (rat): 361818
Entry
361818            CDS       T01003                                 

Gene name
Rsph1, Tsga2
Definition
(RefSeq) radial spoke head 1 homolog
  KO
K19755  radial spoke head protein 1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    361818 (Rsph1)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Others
     361818 (Rsph1)
SSDB
Motif
Pfam: MORN
Other DBs
NCBI-GeneID: 361818
NCBI-ProteinID: NP_001012176
RGD: 1307712
Ensembl: ENSRNOG00000057862
UniProt: Q5XFW9
Position
20p12
AA seq 300 aa
MSDLGSEELEEEGENDLGEYEGERNELGERHGHGKARLPNGDTYEGNYESGKRHGQGTYK
FKNGARYVGDYVKNKKHGQGTFVYPDGSRYEGEWADDQRHGHGVYYYVNNDTYTGEWFNH
QRHGQGTYFYAETGSKYVGTWVHGQQEGAAELIHLNHRYQGKFINKNPVGPGKYVFDVGC
EQHGEYRLTDVERGEEEEEEETLVSIVPKWKALKITELALWTPTLSEEHPPAEGQGQEEV
QGATGAGEPSDDIQAEGFEVDAEPRTGEEDIDFRQESQENSYDLDQGNPNFDEEQLDLQE
NT seq 903 nt   +upstreamnt  +downstreamnt
atgtcggacctgggctctgaggagttagaggaggagggagagaacgatcttggggaatac
gaaggagagcgcaatgaactgggagagcggcacggacatgggaaggcacggttgcccaac
ggggacacatatgaaggaaactatgagtctggaaaaagacatggccagggcacctacaaa
tttaagaatggggcccggtacgttggcgactatgttaaaaataagaagcatggacaaggt
acctttgtctatccagatggttccagatatgaaggggagtgggctgacgaccagaggcat
ggccatggcgtttactactacgtcaataatgacacctacacaggggagtggttcaatcat
caaaggcacgggcaaggcacctacttctacgcggagaccggcagtaagtacgtcggtacc
tgggtgcacgggcagcaggagggtgccgccgagctcatccacctgaatcacaggtaccag
ggcaagttcataaacaaaaaccctgtgggcccgggaaagtacgtatttgacgtgggatgc
gaacagcacggtgaataccgcctcacagatgtggaaagaggtgaagaggaggaggaggaa
gagacattagtgagtatcgttccaaaatggaaagctctcaaaatcacagaattggccttg
tggactccaaccctctccgaggagcatcctcctgctgagggacaagggcaggaagaagtc
cagggagctactggtgctggtgagccctcagatgacatccaggcagaaggttttgaggtc
gacgcagagccgaggacgggcgaagaagacatagacttcaggcaggagagccaggagaac
agttacgacttagaccagggaaacccgaactttgatgaagaacagttagacctccaggag
taa

DBGET integrated database retrieval system