KEGG   Rattus norvegicus (rat): 361833Help
Entry
361833            CDS       T01003                                 

Gene name
Ank3, ANK-3
Definition
(RefSeq) ankyrin 3
  KO
K10380  ankyrin
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    361833 (Ank3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    361833 (Ank3)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filament-binding proteins
    361833 (Ank3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_2 Ank Ank_4 Ank_5 Ank_3 UPA_2 ZU5 Death
Motif
Other DBs
NCBI-GeneID: 361833
NCBI-ProteinID: NP_001029156
RGD: 620157
Ensembl: ENSRNOG00000053288
UniProt: O70511
Structure
PDB: 

Position
20p11
AA seq 2622 aa AA seqDB search
MAHAASQLKKNRDLEINAEEETEKKKKHRKRSRDRKKKSDANASYLRAARAGHLEKALDY
IKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQA
EVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVA
LQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDTNADIESKMVVNRAT
ESGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGA
KIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQL
LLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNR
IRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHM
AARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSG
YTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPD
AAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLE
YGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNV
AEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTPLHQAAQ
QGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTLKVVTEEIMTTTTITEKH
KMNVPETMNEVLDMSDDEVGKASAPEKLSDGEYISDGEEGEDAITGDTDKYLGPQDLKEL
GDDSLPAEGYVGFSLGARSASLRSFSSDRSYTLNRSSYARDSMMIEELLVPSKEQHLPFT
REFDSDSLRHYSWAADTLDNVNLVSSPVHSGFLVSFMVDARGGSMRGSRHHGMRIIIPPR
KCTAPTRITCRLVKRHKLANPPPMVEGEGLASRLVEMGPAGAQFLGPVIVEIPHFGSMRG
KERELIVLRSENGETWKEHQFDSKNEDLSELLNGMDEELDSPEELGTKRICRIITKDFPQ
YFAVVSRIKQESNQIGPEGGILSSTTVPLVQASFPEGALTKRIRVGLQAQPVPEETVKKI
LGNKATFSPIVTVEPRRRKFHKPITMTIPVPPPSGEGVSNGYKGDTTPSLRLLCSITGGT
SPAQWEDITGTTPLTFIKDCVSFTTNVSARFWLADCHQVLETVGLASQLYRELICVPYMA
KFVVFAKTNDPVESSLRCFCMTDDRVDKTLEQQENFEEVARSKDIEVLEGKPIYVDCYGN
LAPLTKGGQQLVFNFYSFKENRLPFSIKVRDTSQEPCGRLSFLKEPKTTKGLPQTAVCNL
NITLPAHKKAEKADRRQSFTSLALRKRYSYLTEPSMKTVERSSGTARSLPTTYSHKPFFS
TRPYQSWTTTPITVPGPAKSGSLSSSPSNTPSASPLKSIWSVSTPSPIKSTLGASTTSSV
KSISDVASPIRSFRTISSPIRTVASPSPYNTQVASGTLGRVPTITEATPIKGVAPNSTLS
SRTSPVTTAGSLLEKSSITMTPPASPKANITMYSSSLPFKSIITSAAPLISSPLKSVVSP
TKSAADVISTAKAAMASTLSSPLKQMSGHAEVALVNGSVSPLKYPSSSALINGCKATATL
QDKISTATNAVSSVVSAAPDTVEKALSTTTAMPFSPLRSYVSAAAPSAFQSLRAPSASAL
YNSLGPSVGVTTSSVTSSIITVPVYSVGNVLAEPALKKLPDSNSLTKSAAALLSPIKTLT
TETRPQPHFNRTSSPVKSSLFLASSALKPSVPSSLSSSQEILKDVAEMKEDLMRMTAILQ
TDVPEEKPFQTDLPREGRIDDEEPFKIVEKVKEDLVKVSEILKKDVCVESKGPPKSPKSD
KGHSPEDDWTEFSSEEIREARQAAASHAPSLPERVHGKANLTRVIDYLTNDIGSSSLTNL
KYKFEEAKKEGEERQKRILKPAMALQEHKLKMPPASMRPSTSEKELCKMADSFFGTDAIL
ESPDDFSQHDQDKSPLSDSGFETRSEKTPSAPQSAESTGPKPLFHEVPIPPVITETRTEV
VHVIRSYEPSTGEIPQSQPEDPVSPKPPPTFMELEPKPTALSIKEKVKAFQMKASSEEED
HSRVLSKGMRVKEETHITTTTRMVYHSPPGSECASERIEETMSVHDIMKAFQSGRDPSKE
LAGLFEHKSAMSPDVAKSAAETSAQHAEKDNQMKPKLERIIEVHIEKGPQSPCERTDIRM
AIVADHLGLSWTELARELNFSVDEINQIRVENPNSLISQSFMLLKKWVTRDGKNATTDAL
TSVLTKINRIDIVTLLEGPIFDYGNISGTRSFADENNVFHDPVDGWQNETPSGSLESPAQ
ARRITGGLLDRLDDSSDQVRDPITSYLTGEAGKFEANGNHAEVIPEAKAKAYFPESQNDI
GKQSIKENLKPKTHGCGRAEEPVSPLTAYQKSLEETSKLVIEDAPKPCVPVGMKKMTRTP
ADGKARLNLQEEEGSARSEPKQGEGYKVKTKKEIRNVEKKAH
NT seq 7869 nt NT seq  +upstreamnt  +downstreamnt
atggctcatgccgcttcccagttaaagaaaaacagggatttagaaatcaatgcggaagaa
gagaccgagaaaaaaaagaagcaccgtaaacggtcccgggatcgcaagaaaaagtcggat
gccaatgcaagttacttgagagcagctcgggcggggcacctggaaaaggcccttgactac
atcaaaaatggagtggacgtcaacatctgtaaccagaatgggttgaatgcgctccatctt
gcttccaaagaaggccatgtggaagtggtctccgagctgctgcagagagaagccaacgtc
gatgcagccacaaagaaaggaaacacagccttacacatcgcatccttggctggacaagcg
gaagtggtcaaggtcttggttacgaacggagcgaacgtcaacgcacagtctcagaatggc
ttcacgccgctgtatatggcggcccaggagaaccacctggaagtcgtcaggtttcttctg
gacaatggtgccagccaaagcctggctacagaggatggcttcacgccattggccgtggct
cttcaacaaggtcacgaccaagtcgtatccctcctgctcgagaacgacacgaagggaaaa
gtgcgcctcccagccctccacatcgcggcccggaaagatgacaccaaagcggcagctctg
ctcctacagaacgacaccaatgcagacatagagtcaaagatggtggtgaatagagcaact
gagagtggcttcaccccactccacatagctgcccactacgggaatatcaatgtggccacg
ttgctgttaaaccgagcggctgccgtggacttcaccgcacggaatgacatcactcctttg
catgttgcctcgaaacggggaaacgcaaatatggtaaagctgttgctcgaccggggtgcg
aagatcgacgccaagaccagggacggtctgaccccgctgcactgcggggcgagaagtggc
cacgagcaggtggtagagatgttgctggacagagccgcccccatcctttcgaaaaccaag
aatggactgtccccactgcacatggccacacaaggagaccatttaaactgcgtccaactc
ctcctccagcacaacgtgcccgtggatgacgtcaccaacgactacctgaccgccctccac
gtggcggcccactgcggccattacaaagttgccaaggttcttttggataagaaagctaac
cccaatgccaaagctctgaatggcttcacccctctccatatcgcctgcaaaaagaaccga
atccgagtaatggaactccttttgaagcacggtgcatctattcaagccgtaaccgagtcg
ggccttaccccaatccatgtcgctgccttcatgggacatgtaaatatcgtgtcacagcta
atgcatcatggagcctccccaaacaccaccaacgtgagaggagaaacagcattgcatatg
gcggctcggtcggggcaagcagaagtggtgcggtatttggtacaagatggagctcaggta
gaagcaaaagctaaggatgaccagaccccactccacatttcagcccgactcgggaaggct
gacatagtgcaacaactgttacagcaaggagcgtccccgaatgcagcaacaacttccggg
tacaccccccttcacctttcggccagagaggggcatgaggatgtagctgccttccttctg
gaccatggagcatctttatccataacaacaaagaagggattcacgcctctgcacgtggct
gcaaaatatgggaagcttgaagtggcaagtctcctgctgcagaagagtgcgtctcctgat
gccgctgggaagagcgggctaactccactgcatgtagcagcacattacgataatcagaaa
gtggcccttctgcttttggaccagggagcctcaccccacgcagctgcaaagaacggttat
acgccactgcacatcgccgccaagaagaaccagatggacatagccacgtccctgctggag
tacggagctgatgcaaacgccgttacccggcaagggattgcgtccgtccaccttgcagcg
caggaagggcacgtggacatggtgtcgctgctcctcagtagaaatgcgaacgtcaacttg
agcaataagagcggcctcaccccactccacctggcggctcaagaagaccgagtgaacgtg
gctgaggtccttgtcaaccaaggggcccacgtggatgcacagacaaagatgggctacacg
ccgctccatgtgggctgtcactatggaaacatcaaaatagtcaattttctgctgcagcat
tctgcgaaagttaatgccaagacaaagaatggatacacgccactgcaccaggcagcccag
cagggccacacacacatcatcaacgtcctgctccagaacaacgcttcccccaatgaactc
actgtgaatgggaacacagccctggccatcgcccgacgccttggctacatctcggtggtt
gacaccctaaaggtcgtgacagaggaaattatgaccaccactaccatcacggagaagcac
aaaatgaatgtcccagaaacgatgaatgaagtcctcgacatgtcagacgatgaagttggt
aaagccagcgcccccgaaaagctcagtgatggggaatatatctcagatggtgaagaaggt
gaagatgccatcacaggggacactgacaagtatctcgggccacaggacctcaaggagctg
ggcgatgactccctgcctgccgagggctatgtgggcttcagtctcggagcccgttctgcc
agccttcgctccttcagttcggataggtcctacaccctgaacagaagctcctatgcgcgg
gacagcatgatgatcgaggagcttctggtgccatccaaagagcagcaccttccattcacg
agggagtttgactccgactccctcagacactacagttgggcagcagacacactggacaat
gtgaacctggtctccagccctgtgcattctgggtttctggttagctttatggtggacgcg
agagggggctccatgcgaggaagccgccaccacgggatgcggatcatcatccctccgcgc
aagtgtacggcccccacccgcatcacttgccgcctggtaaagagacataaactggccaac
ccaccccccatggtggaaggagagggattagccagtaggctggtagaaatgggtcctgcg
ggggcacaatttttaggcccggtcatagtggaaatccctcattttgggtccatgagagga
aaggagagggaactcattgtcctccggagcgagaacggagagacctggaaggaacaccag
tttgacagcaaaaacgaagacctctcggagctcctcaatggcatggacgaagaacttgac
agcccagaagagttgggcacaaagcgcatctgcagaatcatcacgaaggatttcccccag
tatttcgctgtggtttcccggattaagcaggaaagcaaccagattggtcccgaaggtggg
attctgagcagcaccacggtccccctcgtccaggcgtctttcccagagggtgccttaacc
aaaaggatccgtgtgggtctgcaggctcagcccgtaccagaggagactgtgaaaaagatc
cttggaaacaaagcaacgtttagcccaattgtcacggtggagccgaggaggaggaaattc
cataagccgatcaccatgaccatcccggtgcccccaccctcgggagaaggcgtgtccaat
gggtacaagggggacaccacgcccagcctgcgactcctctgcagcattacaggagggacc
tcgccggctcagtgggaagacatcacaggcacaaccccgctgaccttcataaaggactgt
gtgtctttcacaaccaatgtttcagccaggttctggctggcggactgccatcaggtgtta
gaaaccgtagggctagcctcgcagctgtacagagagttgatatgtgtcccctacatggcc
aagtttgttgtttttgccaaaacaaacgacccagtggaatcctccctaaggtgcttctgt
atgacagacgacagagtggacaaaaccctggagcagcaggagaatttcgaggaggttgcc
agaagcaaagacatcgaggttctggaaggaaagcccatctatgttgattgctatggaaac
ctggctcctctgaccaaaggagggcagcagcttgtttttaacttctattctttcaaagaa
aacagactgccattttccatcaaggttagagacaccagccaagagccctgcggccgtctg
tctttcctgaaggagccgaaaacaacaaaaggattaccccaaacggctgtttgcaactta
aatattactctaccggcgcataaaaaggctgagaaggcagacagacgccagagcttcaca
tccctagccttacgtaagcgctacagctacttgactgagcccagcatgaaaacagttgaa
cggagttcaggaacagcaagatcccttcccactacttattcacacaagccattcttttct
acaagaccataccagtcctggactacgactcccataacagtgcccgggccggccaaatca
ggctccttatccagctccccctctaacacgccgtcagcgtctccgttaaaatccatatgg
tctgtttcaacgccttctccgatcaaatccacgctaggcgcctcaactacgtcatcagtc
aaatccattagtgatgtggcgtctcctattagatctttccggacaatttcttcgccaata
agaacggtggcatcgccgtctccatacaatacccaagtagcctctggtacccttgggagg
gtacccaccatcacagaggccacacctataaagggggtggctcccaactcaactttgtcc
tctcgaacttctcctgtgacgaccgcagggtctctgttggagaagtcgtccatcaccatg
acaccccctgcctcccccaaagccaacatcaccatgtattcctccagcttgccatttaag
tccattatcacgtcagcggcaccgctgatctcctcccctttaaagtcagtggtgtctccg
accaagtctgcagctgatgtcatctcaacagctaaagctgcgatggcatcgactctctcc
tcccccttaaagcagatgtctggacatgcagaagtagcgctagtcaatgggtctgtttct
cctctgaagtatccttcctcttccgctttaattaacggatgcaaagccactgccacatta
caggacaaaatttctacagccacaaatgctgtgagctcggtggtgagcgcggcccctgac
acggtggagaaagcgctctccaccacaacagccatgcccttttccccactcaggtcttac
gtttccgctgcagcgccctctgcttttcagtcccttagagctccctctgccagtgcactc
tacaactccctcgggccttcagtaggtgttactacctcatccgtaacttcatcgataatc
acagtgccagtatactcggtaggcaatgttttggcagaaccagcattgaagaaacttcca
gactctaactcgctcacaaaatcggcagcggctttgctgtcgcccattaaaacattgact
acggagacacgtcctcagccccatttcaatcgaacgtcatctcccgtcaagtcctctctg
ttcctggcatcctcggcccttaagccgtcagtaccatcttctttatcttccagtcaggag
atcttaaaagatgtggccgagatgaaggaggacctcatgagaatgaccgccatactgcag
acggatgtgcctgaggagaagccattccagaccgacctcccccgagaagggaggatagac
gacgaagagcctttcaaaatcgttgagaaagtgaaggaagacttagtcaaagtcagtgag
atactcaaaaaggacgtgtgtgtcgagagcaaagggccacccaagtccccaaagagtgac
aaaggacactctccagaagatgactggacggaatttagttctgaggaaatacgagaagcc
aggcaggctgctgccagtcacgccccatccctgcccgagagagtacatggaaaggccaac
ctcaccagagtcatagactacctgaccaatgacatcgggagcagttcactgaccaactta
aagtacaagtttgaagaggctaagaaggaaggagaggagagacagaagagaattttaaag
ccagccatggccttgcaggagcataaactcaaaatgccgccagcctccatgagaccttcc
acctccgagaaggaactgtgcaagatggcggactccttttttggaacagatgccatccta
gagtctcccgatgacttttctcaacatgaccaagacaaaagtcccttgtccgacagtggc
tttgaaacccgaagtgagaaaacaccttcagccccccaaagtgccgagagcaccggccct
aagccactatttcatgaagtccccatcccccctgtcatcacagagacgagaactgaagta
gtccacgtgatcaggagctacgagccctctactggggagatcccccagtcccagccagag
gaccccgtgtctcccaaacctccccctacatttatggagttggaaccaaagcccaccgcc
cttagcattaaggaaaaagtgaaagcattccaaatgaaagccagtagcgaggaagaggac
cacagtcgggttttaagcaaaggcatgcgtgtcaaagaagagactcacatcaccacaacc
acgaggatggtgtatcactccccgcctggcagtgagtgtgcctccgagaggattgaggag
accatgtcagtccatgacattatgaaggcttttcagtccgggcgagacccttccaaagag
ctggcggggctgtttgaacacaagtcggccatgtctccggatgttgccaagtctgctgct
gagacctcggcccagcacgcagagaaggacaaccaaatgaaacccaaactggagcgtatt
atagaggtccacatcgaaaaaggtccacagagtccttgtgagcggacggatatcaggatg
gcaatagtagccgatcacctgggacttagttggacagagctggcaagggaactgaatttt
tcagtggatgaaatcaaccaaatacgagtggaaaatcccaattctttaatttctcagagc
ttcatgttattaaaaaagtgggtgacgagagacgggaagaatgccacaactgatgcctta
acttcggtcttaacaaaaattaaccgaatagacatagtaactctgctggaaggaccaata
tttgattatgggaatatttcaggcaccagaagctttgcagatgaaaacaatgttttccat
gacccagttgatggttggcagaacgagacgccaagtggaagcctagagtccccggcgcaa
gcgcgaagaataaccggtgggttactggaccgtctggacgacagctctgaccaggttcgg
gatcccattacctcatacctcacaggagaagctgggaagttcgaagcaaacggaaaccac
gcagaagtcattccagaagcaaaggccaaggcctactttcctgaatcccaaaacgatata
gggaaacagagcatcaaggagaacttgaaaccaaaaacacacggatgtggtcgcgctgag
gaaccagtgtcgcccctcacagcctaccagaaatctctagaagaaaccagcaagcttgtc
atagaagacgcacctaaaccctgtgtgcctgtcggcatgaaaaagatgaccaggactccg
gctgacggcaaagccaggctcaacctccaggaagaggaggggtccgccaggtcagagcct
aagcagggagaaggctataaggtgaaaacaaagaaggaaatccggaatgtggagaagaaa
gcccactag

DBGET integrated database retrieval system