KEGG   Rattus norvegicus (rat): 361843
Entry
361843            CDS       T01003                                 

Gene name
Aifm2, Amid, Prg3
Definition
(RefSeq) apoptosis inducing factor, mitochondria associated 2
  KO
K22745  apoptosis-inducing factor 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    361843 (Aifm2)
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox Pyr_redox_3 DAO Lycopene_cycl K_oxygenase NAD_binding_8 Thi4 GIDA Trp_halogenase HI0933_like AlaDh_PNT_C FAD_binding_2 FAD_oxidored FAD_binding_3
Other DBs
NCBI-GeneID: 361843
NCBI-ProteinID: NP_001132955
RGD: 1304964
Ensembl: ENSRNOG00000059445
UniProt: D4AA14
Position
20q11
AA seq 373 aa
MGSQVSVDTGAVHVVIVGGGFGGIAAASQLQALNVPFMLVDMKDSFHHNVAALRASVESG
FAKKTFISYSVTFKDNFRQGKVIGIDLKNRMVLLEGGEALPFSHLILATGSTGPFPGKFN
EVSCQQAAIQAYEDMVKQIQRSQFIVVVGGGSAGVEMAAEIKTEYPEKEVTLIHSRVPLA
DKELLPCVRQEVKEILLRKGVQLLLSERVSNLEELPRNEYREYIKVETDKGTEVATNMVI
VCNGIKINSSAYRSAFESRLASNGALKVNEFLQVEGYSNIYAIGDCADIKEPKMAYHAGL
HANIAVANIVNSMKQRPLKAYKPGALTFLLSMGRNDGVGQISGFYVGRLMVRLAKSRDLL
ISTSWKTMRQSPP
NT seq 1122 nt   +upstreamnt  +downstreamnt
atgggctcccaggtctcggtggacacaggagctgtgcacgtggtgatcgtgggcgggggc
tttggagggatagcggccgccagtcagctgcaggctctgaatgtccccttcatgctggtg
gacatgaaggactccttccaccacaatgtggcagccctccgggcctccgtggagagcggg
ttcgccaaaaagacattcatttcttactcggtgaccttcaaggacaacttccgccagggc
aaagtgattggcatagacttgaagaaccggatggtgctgctagagggtggtgaggccttg
cccttctcacatcttattctggccacaggcagtactgggccctttcctggcaaatttaac
gaggtgtcctgccaacaggcagccatccaggcctatgaggacatggtgaagcagatccag
cgctcgcagttcatcgtggtggtgggaggcggctctgcaggagttgagatggccgcagag
attaaaaccgagtaccctgagaaggaggtcactcttatccactccagagtacccctggcg
gacaaggagctcctgccttgtgtgcgacaggaagtgaaggagatcctcctccgaaagggt
gtgcagctgctgctgagtgagcgggtgagcaacctggaggaactgcctcgcaatgagtat
cgggagtacatcaaggtggaaacggacaagggcacagaggtggccaccaacatggtgatt
gtgtgcaatgggatcaagattaacagctctgcctaccgcagtgcgtttgagagtaggctg
gccagcaacggggctctgaaagtgaacgagttcctccaggtggaaggttacagcaacatt
tacgccattggcgactgtgctgacatcaaggagcccaagatggcctatcacgctggcctg
catgccaacattgctgtggccaacattgtcaactccatgaagcagaggcccctcaaagcc
tacaagccaggtgcgctgacattcctcctgtccatgggcagaaacgatggcgtgggccag
atcagtggcttctatgtaggccgcctcatggtgcggctggccaagagcagggaccttctc
atctccacaagctggaaaaccatgcggcaatctccaccatga

DBGET integrated database retrieval system