KEGG   Rattus norvegicus (rat): 361866Help
Entry
361866            CDS       T01003                                 

Gene name
Hace1
Definition
(RefSeq) HECT domain and ankyrin repeat containing, E3 ubiquitin protein ligase 1
  KO
K12166  E3 ubiquitin-protein ligase HACE1 [EC:2.3.2.26]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    361866 (Hace1)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.26  HECT-type E3 ubiquitin transferase
     361866 (Hace1)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  HECT type E3
   361866 (Hace1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HECT Ank_2 Ank_4 Ank_3 Ank Ank_5 TMPIT
Motif
Other DBs
NCBI-GeneID: 361866
NCBI-ProteinID: NP_001102009
RGD: 1306114
Ensembl: ENSRNOG00000000327
UniProt: D3ZBM7
Position
20q13
AA seq 909 aa AA seqDB search
MERAMEQLNRLTRSLRRARTVELPEDNETAVYTLMPMVMADQHRSVSELLSNSKFDVNYA
FGRVKRSLLHIAANCGSVECLVLLLKKGANPNYQDISGCTPLHLAARNGQKKCMSKLLEY
SADVNICNNEGLTAIHWLAVNGRTELLHDLVQHVTDVDVEDAMGQTALHVACQNGHKTTV
QCLLDSGADINRPNVAGATPLYFACSHGQRDTAQILLLRGAKYLPDKNGVTPLDLCVQGG
YGQTCEVLIQYHPRLFQTIVQMTQNEDLRENMLRQVLQHLSQQSESQYLKILTGLAEVAT
TNGHKLLSLSSSYEAQMKSLLRIVRIFCHVFRIGPSSPSNGMDMGYNGNKTPRSQVFKPL
ELLWHSLDEWLVLIATELMKNKEDSADITSILLKQKGQDQEASCISAFEPPGPGSYERLS
TGPGESKPDVLAGKQEASADCQDVISVTANRLSAVIQAFYMCCSCQMPPGMTSPRFIEFV
CKHDEVLKCFVNRNPKIIFDHFHFLLECPELMSRFMHIIKAQPFKDRCEWFYEHLHSGQP
DSDMVHRPVSENDILLVHRDSIFRSSCEIVSKANCAKLKQGIAVRFHGEEGMGQGVVREW
FDILSNEIVNPDYALFTQSADGTTFQPNSNSYVNPDHLNYFRFAGQILGLALNHRQLVNI
YFTRSFYKHILGIPVNYQDVASIDPEYAKNLQWILDNDISDLGLELTFSVETDVFGAMEE
VPLKPGGGSILVTQNNKAEYVQLVTELRMTRAIQPQINAFLQGFHMFIPPSLIQLFDEYE
LELLLSGMPEIDVNDWIKNTEYTSGYEREDPVIQWFWEVVEDMTQEERVLLLQFVTGSSR
VPHGGFANIMGGSGLQNFTIAAVPYTPNLLPTSSTCINMLKLPEYPSKEILKDRLLVALH
CGSYGYTMA
NT seq 2730 nt NT seq  +upstreamnt  +downstreamnt
atggagagagcgatggagcagctcaaccgtctgacgcgctcgctgcgccgcgcgcgcacc
gtggagctgcccgaggataacgagactgctgtttacacattaatgccaatggtgatggcg
gatcagcacaggtctgtttctgaactcctatcaaattcaaaatttgatgtcaattatgca
tttggacgtgtgaagagaagcttgcttcacattgcagcaaactgtggatctgtggagtgc
ttggttcttctgttaaagaaaggagcaaaccccaactaccaagacatttcaggctgtacg
ccccttcatctggccgctaggaacggacagaagaaatgcatgagtaaattactggagtac
agtgcagacgtcaacatttgcaataatgaaggccttaccgcaatccactggctggctgtg
aatggaaggacagagctactccatgacctggtgcagcacgtcacggatgtggatgtggag
gatgcaatggggcagacagcattacatgtggcctgccagaacgggcacaaaacgaccgtg
cagtgtctgctggacagcggtgctgacatcaaccggccgaatgtggcaggagctacgcca
ctgtactttgcttgcagtcatggccagagagatactgcgcagattcttctattacgagga
gccaaatatttaccagataaaaacggagtaacccctctggacctgtgtgtgcagggtggc
tatggacagacttgcgaagtgttaattcagtatcaccccaggcttttccagacgattgtt
caaatgacgcagaatgaagaccttcgggagaacatgttacggcaagttctgcagcatttg
tctcagcagagtgaaagccagtacctaaagatcctgacaggtcttgctgaagttgctaca
acaaatggccataaactgcttagtctgtccagcagctacgaggcgcagatgaagagcctc
ctgcggatcgtgaggatcttctgccacgtcttccgcattggcccctcgtctcccagtaac
ggcatggatatgggctacaatgggaataagactccaaggagccaggtgttcaagcctttg
gaattgctttggcactctctggatgagtggttggttttaatagccacagaattaatgaag
aacaaagaggactcagcggatatcacctccattttactgaaacagaaaggccaggatcaa
gaggcctcttgtatttcagcgtttgagccaccaggacctgggagctatgaacgcctgtcc
actggtcccggggaatccaaaccagatgtgcttgccgggaagcaggaagccagtgcggac
tgtcaggatgtcatttctgtgacggccaaccggctaagtgctgtcattcaagccttttac
atgtgctgctcctgtcagatgcctccaggaatgacgtcgcctcggttcattgagtttgtc
tgcaagcatgatgaagtgctaaagtgctttgtgaatagaaatcccaaaattatatttgac
cattttcactttcttcttgaatgtcctgaactgatgtcgagattcatgcacatcataaag
gcacagccattcaaagaccgctgtgaatggttctatgagcatttgcactcaggacagcca
gactcagacatggtgcacagaccagtgagtgaaaacgacattctcctggttcacagagat
tctatttttaggagtagctgtgaaatcgtatcaaaggccaactgtgcaaagctgaagcag
gggatcgctgtgcgctttcatggagaggaaggcatgggtcaaggtgttgtacgtgaatgg
tttgatattctgtctaatgagatagtcaatcctgactatgcactgtttacccagtcagca
gatggaacaacttttcagcccaatagcaactcctatgtcaatcctgatcacttgaactat
ttccggtttgctggacagatcttgggattagctttgaatcacaggcagttggtcaatatt
tacttcacacgatccttctacaaacacattcttggtattcctgtgaattaccaagatgta
gcgtctatcgatccagaatatgccaaaaatctgcagtggattttagacaatgacattagt
gacctgggtctagaactgactttctctgttgagactgatgtgtttggagctatggaagag
gtaccgttaaagcctgggggtggaagtattcttgtgacacaaaataacaaagcggagtac
gtccagctggttactgaactccggatgacaagagccattcagcctcagatcaatgcgttt
ttacagggtttccatatgttcatccctccttccctcatacagctgttcgacgagtatgaa
ttggagctactgctctctggcatgccggaaattgacgtgaatgattggatcaaaaataca
gaatacacaagtggctatgaaagggaagatccagttattcagtggttctgggaggttgtg
gaggacatgactcaagaagagcgggtccttctcttacagttcgtgactggcagttccagg
gtcccgcatggtggctttgccaatatcatgggtggcagtggtttgcaaaactttacaatt
gctgctgtgccatatactccaaatcttttaccaacttccagcacgtgcatcaacatgctc
aagttacctgaatacccaagtaaagagatcctcaaggacagactcctcgtagctctgcat
tgtggcagctacggctatacaatggcttag

DBGET integrated database retrieval system