KEGG   Rattus norvegicus (rat): 361879
Entry
361879            CDS       T01003                                 

Gene name
Wdr41
Definition
(RefSeq) WD repeat-containing protein 41
  KO
K23610  WD repeat-containing protein 41
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04140  Autophagy - animal
rno05014  Amyotrophic lateral sclerosis
rno05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    361879 (Wdr41)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    361879 (Wdr41)
   05022 Pathways of neurodegeneration - multiple diseases
    361879 (Wdr41)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    361879 (Wdr41)
Membrane trafficking [BR:rno04131]
 Autophagy
  Other autophagy associated proteins
   Rab associated proteins
    361879 (Wdr41)
SSDB
Motif
Pfam: WD40
Other DBs
NCBI-GeneID: 361879
NCBI-ProteinID: NP_001102011
RGD: 1306363
Ensembl: ENSRNOG00000025462
UniProt: D4A0P5
Position
2
AA seq 244 aa
MLRWLIGGGREPQGLAEKAALQTIGEDQGQNPYTELLVLKAHRDIVRFLVQLDGYRFASA
GDDGIIVVWNAQTGEKLLELRGHTQKITAVITFLPLDSCEASSQLLLTASADRTVVWDCD
TGRQIQRVTCFQSTVKCLAVLQRLDVWLSGGSDLGVWSRKLDLLCKTSHLSDTGISALVE
IPGNCVAAAVGRELIIFRLVTPTEELLEWDIIEVKRLLDHQDNILSLANINERICSSWKG
VIRV
NT seq 735 nt   +upstreamnt  +downstreamnt
atgctgcgctggctgatcggaggaggccgcgagccgcagggcctggccgagaaagctgct
ctgcagacaataggagaggaccaaggtcagaacccctacactgaactgctggtactgaag
gctcatcgcgacattgtccgcttcctggtgcagctagacggctacaggtttgcatctgct
ggtgatgatggaattatagttgtgtggaatgcccagacaggagaaaaacttctggaactc
agaggacatactcagaagataacggctgtcattacgttccttcccctagactcttgtgag
gccagcagtcagcttctcttgacagcctctgctgaccggactgtcgtttgggactgtgac
accggccggcaaatccagagggtcacgtgcttccagtctactgtcaagtgcttggctgtc
cttcagaggctggacgtctggctctcaggcggaagtgacctgggtgtgtggagccgaaaa
ttagacctgctgtgtaagaccagccacctttctgacacagggatcagtgctttggttgaa
atccctgggaactgtgtcgctgcagccgttggcagagaattgatcatttttaggcttgta
acacccacagaagaactgcttgaatgggatattatagaggttaaacgccttctcgatcac
caggacaatatcctgtcattggctaacatcaatgaacgtatttgcagcagttggaagggg
gttatacgtgtataa

DBGET integrated database retrieval system