KEGG   Rattus norvegicus (rat): 361916Help
Entry
361916            CDS       T01003                                 

Gene name
Chmp4c
Definition
(RefSeq) charged multivesicular body protein 4C
  KO
K12194  charged multivesicular body protein 4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04144  Endocytosis
rno04217  Necroptosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    361916 (Chmp4c)
  09143 Cell growth and death
   04217 Necroptosis
    361916 (Chmp4c)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    361916 (Chmp4c)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    361916 (Chmp4c)
Membrane trafficking [BR:rno04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-III complex
    361916 (Chmp4c)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   361916 (Chmp4c)
  Exosomal proteins of other body fluids (saliva and urine)
   361916 (Chmp4c)
  Exosomal proteins of colorectal cancer cells
   361916 (Chmp4c)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Snf7
Motif
Other DBs
NCBI-GeneID: 361916
NCBI-ProteinID: NP_001017466
RGD: 1564543
Ensembl: ENSRNOG00000010238
UniProt: Q569C1 F1LPT7
Position
2q23
AA seq 232 aa AA seqDB search
MSKLGKFFKGSRSSRARAAPSAQEALARLRETEEMMAKKQEYLENRIQRELALAKKHGSQ
NKRAALQALKRKKRFEKQLTQIDGTLSTIEFQREALENSHTNTEVLRNMGFAAKAMKAVH
ENMDLNKIDDLMQDITEQQDIAQEISEAFSQRVQFADGFDEDELLAELEELEQEELNKKM
TSMELPNVPSSSLPAQPSRKAGVPSSVHRSRAASSRRAEEDDDFKQLAAWAT
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagttgggcaagtttttcaaagggtctcgctcttctcgggcccgcgcggctccc
agcgctcaggaagccctggctcgactccgggagaccgaggagatgatggccaagaagcag
gagtacctggagaaccgaatccagagggagcttgctctagccaagaagcacggctcccag
aacaagcgagctgccttgcaggcactgaaaagaaagaagagatttgagaagcagctcaca
cagattgacggcaccctttccaccattgagttccagcgggaggcgctagagaactcacac
accaacactgaggtcttacggaacatgggcttcgcagccaaggccatgaaagctgttcat
gaaaacatggatctcaacaaaatcgatgacttgatgcaagacatcacagagcagcaggac
attgcccaggaaatctcagaagcgttttctcaaagagttcagtttgctgatggcttcgat
gaggatgagcttctggcggagctcgaggaactggagcaggaagaattaaataagaagatg
acaagcatggagctcccaaatgtgccttcctcatccctcccagcacagcccagcaggaag
gccggcgtgccttcctctgtgcaccgctctcgagcagcatcttccaggagggcagaggaa
gatgatgacttcaagcagctggcagcctgggccacttaa

DBGET integrated database retrieval system