KEGG   Rattus norvegicus (rat): 361930Help
Entry
361930            CDS       T01003                                 

Gene name
Bbs7
Definition
(RefSeq) Bardet-Biedl syndrome 7
  KO
K16749  Bardet-Biedl syndrome 7 protein
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    361930 (Bbs7)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   BBSome complex
    361930 (Bbs7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BBS2_C BBS2_Mid FlxA
Motif
Other DBs
NCBI-GeneID: 361930
NCBI-ProteinID: NP_001012180
RGD: 1309264
Ensembl: ENSRNOG00000015816
UniProt: Q66H90
Position
2q25
AA seq 715 aa AA seqDB search
MDLTLSRADYLQVGVTSQKTMKLLPTSRQRATQKVVIGDQDGVVMCFGMKKGEAVSVFKT
LPGQKVSRLELGGALNTPQEKIFIAAGSEIRGFTKRGKQFLSFETNLTESIKAMYISGSD
LFLSASYIYNHYCDCKDQNYYLSGDKINDVICLPVERLSRVTPVLACQDRVLRVLQGSDV
TYEIEVPGPPTVLALHNGDGGDSGEGLLFGTSDGRLGLIQITASKPIHKWEIRNDKKRGG
ILCLDSFDIMGDGVKDLLVGRDDGMVEVYSFENANEPVLRFDQMLSESVTSVQGGCVGKD
GYDEIVLATYSGWVTGLTTEPTHKESGPGEELKLNQEMQNKIASLRTELEHLQLKVLQER
ENYQQSSQSSQAKSTVPSFSINDKFTLNKDDASYSLVLEVRTAIDNVLIQSDVPIDLLDV
DKNSAVVSFSSCDTESNDNFLLATYRCQANTTRLELKIRSIEGQYGTLQAYVTPRIQPKT
CQVRQYHIKPLSLHQRTHFIDHDRPMNTLTLTGQFSFAEVHSWAVLCLPEVPEKPPAGEC
ATFYFQNTFLDTQLECAYRKGEGIFKSDNISTISILKDVLSKEATKRKINLNISYEINEV
SVKHTLKLIHPKLEYQLLLAKKVQLIDALKELQVHEGNTSFLIPEYRCILEEADHLQEEY
KKQPAHLERLYGMITDLFIDKFKFKGTNVKTKVPVLLEILDSYDQNTLISFFDAA
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atggatctgacgttaagccgagcagactatctccaggtaggagtgacctctcagaagact
atgaagttgcttcctacctcaagacaaagagctacacaaaaggtggtcattggagatcaa
gatggggtggtgatgtgcttcggcatgaagaaaggcgaggcggtgtcagtgttcaagact
ttaccagggcagaaggtttccaggctggaactaggaggggctctgaatacgcctcaggag
aaaatcttcattgctgcagggtccgagattagaggctttacaaagagagggaaacagttt
ctctcttttgaaacaaacctcacagaaagcattaaagctatgtatatatctggctccgac
ctcttcctcagtgccagctacatctataatcactactgtgactgcaaagaccaaaactat
tacctttctggggacaaaatcaatgatgtcatctgccttcctgtggaaaggttatcccgt
gtgacaccggtgttggcctgccaggacagggttctccgagtcttacagggatctgatgtg
acgtatgaaatcgaggttcctggtccacccactgtcttagcgctgcataatggagacgga
ggtgactctggggaaggtcttctgttcggcacatcagatggaaggcttgggcttattcag
atcacagcatccaaaccaatacacaaatgggaaattcgaaatgacaaaaagcggggaggt
atcttgtgtcttgacagctttgatatcatgggtgatggggttaaagatttacttgttggg
agagatgatggaatggtggaagtgtatagttttgagaatgcaaatgaacccgtgctacga
tttgatcagatgctgtctgaaagtgtcacatcagtccagggtggctgtgtagggaaagat
ggttatgacgaaatcgtgctggccacgtattcaggctgggtgacagggctgactacagag
cccactcataaggaaagtgggccaggagaagaactgaaactcaatcaggaaatgcagaat
aagattgcttctttaaggactgaattagaacatctgcagttgaaggtgcttcaggagaga
gaaaattaccaacagtcttcacagtcgagccaagcaaagtcaacagtcccttcattcagt
ataaacgacaagttcacattgaataaagatgatgctagctacagccttgtgttagaggtg
cggactgcaatagataatgtcttaatacagagtgatgttccaatagacctactcgatgtg
gataagaattctgctgttgtgagctttagcagctgtgacacagagtcaaacgacaacttc
cttctcgccacttatcggtgccaggcaaacaccaccaggctggagctcaagatccgttca
attgaaggccagtatggcacactccaggcatatgtgactccaagaatccaaccgaaaacc
tgtcaggttcgccagtaccacatcaaacctctgtcgctccatcaaagaactcactttatt
gaccacgacaggcccatgaacacgctgactctaacaggccagttcagcttcgccgaggtt
cactcctgggccgtgctctgcctgcctgaagtgccggaaaagcctccagcgggggaatgt
gcaactttctactttcagaatacctttctggacacacagctggagtgtgcatacagaaaa
ggagaaggaatctttaaatctgacaacatctctacaatatccatcctaaaagatgtgctt
tctaaagaagctacaaaaaggaaaattaatctcaacatatcatacgagataaatgaagtg
tcagtcaagcatactttaaagctaattcacccaaagttggagtaccagttgcttctggct
aagaaagtacagttaattgatgccttgaaggaattacaggttcatgagggaaatacaagc
tttctgattccagagtatcgctgtatcctagaagaggctgatcatctacaagaggaatac
aaaaagcagcctgcccatcttgaaagactctatggtatgattactgatcttttcatagat
aaatttaagttcaaaggcactaatgtaaaaaccaaagtacctgtactcctggagattctc
gacagctatgaccagaacacactgatttctttctttgatgcagcatga

DBGET integrated database retrieval system