KEGG   Rattus norvegicus (rat): 361939Help
Entry
361939            CDS       T01003                                 

Gene name
Mfsd8, Ab2-276, RGD1310132
Definition
(RefSeq) major facilitator superfamily domain containing 8
  KO
K12307  MFS transporter, ceroid-lipofuscinosis neuronal protein 7
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04142  Lysosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    361939 (Mfsd8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    361939 (Mfsd8)
Transporters [BR:rno02000]
 Major Facilitator Superfamily (MFS)
  Unknown transporters
   Others
    361939 (Mfsd8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MFS_1 Sugar_tr
Motif
Other DBs
NCBI-GeneID: 361939
NCBI-ProteinID: NP_001041375
RGD: 1310132
Ensembl: ENSRNOG00000012729
UniProt: Q7TP49
Position
2q25
AA seq 515 aa AA seqDB search
MKHTHTRTHARTHAHTHARMHTLPLEIFWPSPSSDEKFEASGARPVTYRPLADAHLKGVR
QGSGHPSSSRSRNWTFASGAVAECFDSSGQEGASGARVGSAPPSECCHYGEPGKRGREGA
PPGHWLARKQIDQTADASFLGWVIASYSLGQMVASPLFGLWSNYRPRKEPLIVSIFISVA
ANCLYAYVHVPAAHNKYYMLIARGLVGFGAGNVAVVRSYIAGATSLQERTGAMANTSTCQ
ALGFILGPGSYSNQCWLYPWISMAMCVTLKLCQEWSVLSTRLNCTVQENADELQIPEGSI
DQVAVVATNIVFFVVLFIFAVYETILTPLTMDMYAWTQEQAVLYNGIILVAFGVEAVLVF
MGVKLLSKNSTPNTTFGEIIIDLWNSPREDHSEQPTGCPIEQAWCLYTPVIHLAQFLTAA
VLVGIGYPACSVMSYTLYSKVLGPKPQGIYMGWLTTSGSAARILGPVFISHVYTYLGPRW
AVSLVCGIVAFTILLIGAVYKRLVAFSVRYGRIQE
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atgaaacacacacacacacgcacgcacgcacgcacacacgcacacacgcacgcacgcatg
cacactctacctcttgagatcttctggccttccccatcctctgatgaaaagtttgaagcc
agtggcgcacggcctgttacttacaggccgctcgcggacgcacacctaaagggagttcgc
caaggctctgggcaccccagctcttcacgctctaggaactggactttcgcttcaggcgca
gttgccgagtgtttcgacagctccggccaggaaggagcttcgggcgcgagagtgggcagc
gcgccgcctagtgagtgctgtcattatggcgaacctgggaagcgaggccgagagggagcc
cctcctgggcactggctcgcccggaagcagattgatcagacagctgatgcaagttttttg
ggctgggttattgcttcatatagtcttggccaaatggtagcttcacctctatttggctta
tggtctaattataggccaagaaaagaacctcttatcgtctccatctttatttcggtggca
gccaattgcttgtacgcatatgtccatgtgccagctgctcataataaatactacatgttg
attgctcgtggattggtcggattcggagcaggaaatgtagctgttgtccgatcatacatt
gccggtgctacttcccttcaggaaagaacgggtgccatggctaatacgagcacatgccaa
gccctgggctttattctgggtccaggttcctacagcaaccagtgctggctgtacccttgg
atttctatggctatgtgtgtgactttgaagctgtgtcaggaatggtctgtactcagtaca
cgacttaattgcacagttcaagaaaatgcagatgaacttcagattcctgaaggaagtatt
gatcaagttgctgttgtggccaccaatattgtgttttttgtggttttgtttatctttgct
gtttatgaaacaatcctcactccattaacgatggacatgtacgcctggacccaggagcag
gctgtgctctataatggaataatccttgttgcttttggagttgaggcagttcttgttttc
atgggtgttaaattactttccaaaaactcaacccctaatactacatttggggaaattatt
attgatctttggaattctccaagagaagatcacagtgaacagccaactggatgcccaatt
gaacaggcctggtgcctatacaccccagtgattcatctggcccagttcctgacagctgct
gtgctagttggaataggctatccagcctgcagtgtcatgtcctatacattatactcaaaa
gttctaggacccaaacctcagggtatatacatgggctggttaaccacttctggaagtgca
gcacggattcttgggcctgtgttcatcagccatgtgtacacttacttgggcccacgatgg
gcagtcagccttgtgtgtggaatagtagcgttcaccatcttgctaataggagctgtttac
aaaagactcgttgccttttctgtcagatatgggaggatccaggagtaa

DBGET integrated database retrieval system