KEGG   Rattus norvegicus (rat): 361945
Entry
361945            CDS       T01003                                 

Gene name
Postn, Plf
Definition
(RefSeq) periostin
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: Fasciclin GT-D
Other DBs
NCBI-GeneID: 361945
NCBI-ProteinID: NP_001102020
RGD: 1305285
Ensembl: ENSRNOG00000012660
UniProt: D3ZAF5
Position
2q26
AA seq 810 aa
MVPLLPLSALLLLFLCDVDPANANSYYDKVLAHSRIRGRDQGPNVCALQQILGTKKKYFS
SCKNWYQGAICGKKTTVLYECCPGYMRMEGMKGCPAVMPIDHVYGTLGIVGATTTQHYSD
VSKLREEIEGKGSYTYFAPSNEAWDNLDSDIRRGLENNVNVELLNALHSHMVNKRMLTKD
LKHGMVIPSMYNNLGLFINHYPNGVVTVNCARVIHGNQIATNGVVHVIDRVLTQIGTSIQ
DFIEAEDELSSFRAAAITSDLLESLGRDGHFTLFAPTNEAFEKLPRGVLERIMGDKVASE
ALMKYHILNTLQCSEAITGGAVFETMEGNTIEIGCEGDSISINGIKMVNKKDIVTKNGVI
HLIDEVLIPDSAKQVIELAGKQQTTFTDLVAQLGLASSLKPDGEYTLLAPVNNAFSDDTL
SMDQRLLKLILQNHILKVKVGLSDLYNGQILETIGGKQLRVFVYRTAICIENSCMVRGSK
QGRNGAIHIFREIIQPAEKSLHEKLRQDKRFSIFLSLLEAADLKDLLTQPGDWTLFAPTN
DAFKGMTNEEREILIGDKNALQNIILYHLTPGVYIGKGFEPGVTNILKTTQGSKIYVKGV
NETLLVNELKSKESDIMTTNGVIHVVDKLLYPADIPVGNDQLLELLNKLIKYIQIKFVRG
STFKEIPMTVYTTKIITKLVEPKIKVIQGSLQPIIKTEGPAMTKIHIEGEPDFRLIKEGE
TVTEVIHGEPVIKKYTKIIDGVPVEITEKETREERIITGPEIKYTRISTGGGETEETLQK
FLQKDTPAKKIQANKRVQGSRRRSREGRSQ
NT seq 2433 nt   +upstreamnt  +downstreamnt
atggttcctctcctgcccttatctgctctgctgctgctgttcctgtgtgacgttgacccc
gcaaatgccaacagttactatgacaaggtcctagctcacagccgcatcaggggtcgggat
cagggcccaaatgtctgtgccctccagcagattctgggcaccaaaaagaaatacttcagc
tcctgtaagaactggtatcaaggtgctatctgcgggaagaaaaccactgtgctatatgaa
tgctgccccggctatatgagaatggaagggatgaaaggctgcccagcagtgatgcccatt
gaccatgtttatggcacgctgggcatcgtgggagccacgaccactcaacactattctgat
gtctcgaagctcagggaagagattgaaggaaaagggtcctacacatacttcgcgccgagt
aacgaagcttgggacaacctggattccgacatccgcagaggactagagaacaatgtcaat
gttgagttactgaacgctttacacagccacatggttaataagagaatgctaaccaaggac
ctgaaacacggcatggttattccttcaatgtacaacaatctggggctttttatcaatcat
tatcccaatggggttgtcactgtgaactgtgctcgagtaatccacgggaaccagattgcc
acaaatggtgttgtccatgtcatcgaccgtgtcctgacacaaattggcacctccatccaa
gacttcattgaagcagaagatgagctttcatcattcagagcggctgccatcacttctgac
cttttggagtcccttggaagagacggtcacttcacactctttgctcccaccaatgaggct
ttcgagaaactcccacgaggagtcctagaaaggatcatgggagacaaagtggcttctgaa
gctctcatgaagtaccacatcctgaataccctccagtgctctgaggctatcacaggagga
gcggtgtttgagaccatggaaggaaacactattgaaatagggtgtgagggagacagcatc
tccattaacggaatcaagatggtgaacaagaaagacattgtgacgaagaatggtgtcatc
cacctgattgatgaagtcctcattcctgattctgctaaacaagttattgagctggctgga
aaacagcaaaccactttcacggacctggtagcccagttagggttggcgtcttctctgaag
ccggatggagagtacacgctgttagcgcctgtgaacaatgcgttctctgatgacactctg
agcatggaccagcgccttcttaagctaattctgcaaaatcacatattgaaagtaaaagtc
ggccttagtgatctctacaatggacagattctggagaccattggaggcaaacaactccgt
gtcttcgtgtatcggacggctatctgcatagaaaactcatgcatggtgagaggaagcaag
caggggaggaacggtgccattcacatattccgagagatcatccaaccggcggagaagtcc
ctgcacgaaaaactgcgccaagataagcgcttcagcatcttcctcagcctcctcgaagct
gcagatctgaaagatcttctgacacagcccggagattggaccttgtttgcaccaaccaat
gatgccttcaagggaatgactaatgaagaaagggagattctgattggggataaaaatgct
ctccaaaacatcattctttaccacctgaccccaggggtttatattggaaagggatttgaa
cccggagtcaccaacatcctgaagaccacacagggaagcaaaatctatgtgaaaggagtc
aatgagacgcttttggtgaatgagttgaagtccaaagaatctgacatcatgacaacaaac
ggcgtcattcacgttgtggacaaactcctctatccagcagacattccggttggaaatgat
cagctcttggaattactgaacaaactgataaaatacatccaaattaagttcgttcgtggc
agcaccttcaaagaaatccccatgactgtctatacaactaaaattataaccaaactcgtg
gaaccaaaaattaaagtcattcaaggcagtcttcagcctattatcaaaacagaaggacct
gcaatgacgaagatccacattgaaggcgagcctgacttcaggctgattaaagaaggtgaa
acagtgacagaagtgatccacggagaaccagtcattaaaaagtacaccaaaatcatagac
ggggttcctgttgaaataactgaaaaagagacccgggaagaacgcatcatcacaggtcct
gagataaaatacactaggatttccacaggaggtggggaaacagaagagaccctgcagaaa
ttcttgcaaaaagacacacctgcaaagaagatacaagccaacaaaagggttcaagggtct
agaaggcgatcaagagaaggccgttctcagtga

DBGET integrated database retrieval system