KEGG   Rattus norvegicus (rat): 361967
Entry
361967            CDS       T01003                                 

Gene name
Ppid
Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase D
  KO
K05864  peptidyl-prolyl isomerase D [EC:5.2.1.8]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04217  Necroptosis
rno04218  Cellular senescence
rno05010  Alzheimer disease
rno05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    361967 (Ppid)
   04218 Cellular senescence
    361967 (Ppid)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    361967 (Ppid)
   05022 Pathways of neurodegeneration - multiple diseases
    361967 (Ppid)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:rno03110]
    361967 (Ppid)
Enzymes [BR:rno01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     361967 (Ppid)
Chaperones and folding catalysts [BR:rno03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    361967 (Ppid)
SSDB
Motif
Pfam: Pro_isomerase TPR_1 TPR_2 TPR_7 TPR_12 TPR_11 TPR_19 TPR_16 TPR_8 TPR_17
Other DBs
NCBI-GeneID: 361967
NCBI-ProteinID: NP_001004279
RGD: 1303174
Ensembl: ENSRNOG00000027408
UniProt: Q6DGG0
Position
2
AA seq 370 aa
MSHPSPAGKPSNSKNPRVFFDVDIGGERVGRIVLELFADIVPKTAENFRALCTGEKGTGP
TTGKPLHFKGCPFHRIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDREGLLSM
ANAGPNTNGSQFFITTVPTPHLDGKHVVFGQVIKGLGVARMLENVEVNGEKPAKLCVIAE
CGELKEGDEWGIFPKDGSGDSHPDFPEDADIDLKDVDKILLISEDLKNIGNTFFKSQNWE
MAIKKYAKVLRYLDSSKAVIEKADVSRLQPIALSCVLNIGACKLKMSNWQGAIDSCLEAL
EMDPSNTKALYRKAQGWQGLKEYDQALADLKKAQEIAPGDKAIQAELLKVKQMIKAQKDK
EKAVYAKMFA
NT seq 1113 nt   +upstreamnt  +downstreamnt
atgtcccacccatccccagcaggcaagccctccaattccaagaacccgcgagtcttcttt
gacgtggacatcggcggggagcgagttggacgaattgttttagaattgtttgcagatatt
gttcctaaaactgcagaaaattttcgtgcattgtgtacaggagaaaagggcactggaccg
acaactgggaaacctctgcattttaaaggatgccctttccaccgaattattaagaaattt
atgattcagggtggagacttctcaaatcagaatgggacaggtggagaaagtatttatggt
gaaaaatttgaagatgagaattttcattataagcatgatcgggagggtttgctgagcatg
gcaaatgcaggccccaatacaaatggttctcagttctttatcacaacagttccaactcct
catttggatgggaaacatgtggtatttggtcaagtaataaaaggactaggtgtggcaagg
atgcttgaaaatgtagaagtgaatggtgaaaaacctgccaaactctgtgttattgcagaa
tgtggagaattgaaggaaggggatgaatggggaatattccccaaagatggctctggggat
agtcatccagatttccctgaggatgcagacatagacttaaaggatgtagataaaatttta
ttaatatctgaagacttaaaaaacattggaaatacttttttcaagtctcaaaactgggag
atggctattaaaaaatatgcaaaggttttaaggtacttggatagttcaaaggctgttatt
gagaaagcagatgtatccagactgcaacccatagccttaagttgtgtgctgaatattggt
gcttgtaaattgaagatgtcaaattggcagggggcaattgacagttgcttggaggctctt
gaaatggacccttcaaacactaaagcactataccgaaaagcacaaggatggcaaggattg
aaagaatatgatcaagcattggctgatcttaagaaggcgcaggagatagccccaggagat
aaagctatccaggcagaattgcttaaagtcaaacaaatgataaaggcacagaaagataaa
gagaaggcagtgtatgcaaaaatgtttgcttaa

DBGET integrated database retrieval system