KEGG   Rattus norvegicus (rat): 361967Help
Entry
361967            CDS       T01003                                 

Gene name
Ppid, Cyp-40, CypD
Definition
(RefSeq) peptidylprolyl isomerase D
  KO
K05864  peptidyl-prolyl isomerase D [EC:5.2.1.8]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04217  Necroptosis
rno04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    361967 (Ppid)
   04218 Cellular senescence
    361967 (Ppid)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:rno03110]
    361967 (Ppid)
Enzymes [BR:rno01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     361967 (Ppid)
Chaperones and folding catalysts [BR:rno03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    361967 (Ppid)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_isomerase TPR_1 TPR_2 TPR_7 TPR_12 TPR_11 TPR_8 TPR_19 TPR_9 TPR_16 TPR_17
Motif
Other DBs
NCBI-GeneID: 361967
NCBI-ProteinID: NP_001004279
RGD: 1303174
Ensembl: ENSRNOG00000027408
UniProt: Q6DGG0
Position
2q33
AA seq 370 aa AA seqDB search
MSHPSPAGKPSNSKNPRVFFDVDIGGERVGRIVLELFADIVPKTAENFRALCTGEKGTGP
TTGKPLHFKGCPFHRIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDREGLLSM
ANAGPNTNGSQFFITTVPTPHLDGKHVVFGQVIKGLGVARMLENVEVNGEKPAKLCVIAE
CGELKEGDEWGIFPKDGSGDSHPDFPEDADIDLKDVDKILLISEDLKNIGNTFFKSQNWE
MAIKKYAKVLRYLDSSKAVIEKADVSRLQPIALSCVLNIGACKLKMSNWQGAIDSCLEAL
EMDPSNTKALYRKAQGWQGLKEYDQALADLKKAQEIAPGDKAIQAELLKVKQMIKAQKDK
EKAVYAKMFA
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgtcccacccatccccagcaggcaagccctccaattccaagaacccgcgagtcttcttt
gacgtggacatcggcggggagcgagttggacgaattgttttagaattgtttgcagatatt
gttcctaaaactgcagaaaattttcgtgcattgtgtacaggagaaaagggcactggaccg
acaactgggaaacctctgcattttaaaggatgccctttccaccgaattattaagaaattt
atgattcagggtggagacttctcaaatcagaatgggacaggtggagaaagtatttatggt
gaaaaatttgaagatgagaattttcattataagcatgatcgggagggtttgctgagcatg
gcaaatgcaggccccaatacaaatggttctcagttctttatcacaacagttccaactcct
catttggatgggaaacatgtggtatttggtcaagtaataaaaggactaggtgtggcaagg
atgcttgaaaatgtagaagtgaatggtgaaaaacctgccaaactctgtgttattgcagaa
tgtggagaattgaaggaaggggatgaatggggaatattccccaaagatggctctggggat
agtcatccagatttccctgaggatgcagacatagacttaaaggatgtagataaaatttta
ttaatatctgaagacttaaaaaacattggaaatacttttttcaagtctcaaaactgggag
atggctattaaaaaatatgcaaaggttttaaggtacttggatagttcaaaggctgttatt
gagaaagcagatgtatccagactgcaacccatagccttaagttgtgtgctgaatattggt
gcttgtaaattgaagatgtcaaattggcagggggcaattgacagttgcttggaggctctt
gaaatggacccttcaaacactaaagcactataccgaaaagcacaaggatggcaaggattg
aaagaatatgatcaagcattggctgatcttaagaaggcgcaggagatagccccaggagat
aaagctatccaggcagaattgcttaaagtcaaacaaatgataaaggcacagaaagataaa
gagaaggcagtgtatgcaaaaatgtttgcttaa

DBGET integrated database retrieval system