KEGG   Rattus norvegicus (rat): 361969Help
Entry
361969            CDS       T01003                                 

Gene name
Fga, Ac1873, Fba5e
Definition
(RefSeq) fibrinogen alpha chain
  KO
K03903  fibrinogen alpha chain
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04610  Complement and coagulation cascades
rno04611  Platelet activation
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    361969 (Fga)
   04611 Platelet activation
    361969 (Fga)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    361969 (Fga)
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    361969 (Fga)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   361969 (Fga)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Haparin
  Extracellular matrix molecules
   361969 (Fga)
 Hyaluronan
  Extracellular matrix or blood plasma proteins
   361969 (Fga)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fibrinogen_C Fib_alpha Fibrinogen_aC ORF6C DUF913
Motif
Other DBs
NCBI-GeneID: 361969
NCBI-ProteinID: NP_001008724
RGD: 2603
Ensembl: ENSRNOG00000024848
UniProt: Q7TQ70
Position
2q34
AA seq 782 aa AA seqDB search
MLSLRVACLILSLASTVWTADTGTTSEFIEAGGDIRGPRIVERQPSQCKETDWPFCSDED
WNHKCPSGCRMKGLIDEANQDFTNRINKLKNSLFDFQKNNKDSNSLTRNIMEYLRGDFAN
ANNFDNTFGQVSEDLRRRIEILKRKVIEKAQQIQVLQKDVRDQLIDMKRLEVDIDIKIRS
CKGSCSRSVSREINLKDYEGQQKQLEQVIAKELLPAKDRQYLPAIKMSPVPDLVPGSFKS
QLQEGPPEWKALTEMRQMRMELERPGKDGASRGDLPGDSRGDSATRGPGSKIENPMTPGH
GGSGYWRPGSSGSGSDGNWGSGTTGSDDTGTWGAGSSRPSSGSGNLKPSNPDWGEFSEFG
GSSSPATRKEYHTGKLVTSKGDKELLIGNEKVTSTGTSTTRRSCSKTITKTVLGNDGHRE
VVKEVVTSDDGSDCGDGMDLGLTHSFSGRLDELSRMHPELGSFYDSRFGSLTSNFKEFGS
KTSDSDIFTDIENPSSHVPEFSSSSKTSTVRKQVTKSYKMADEAASEAHQEGDTRTTKRG
RARTMRDCDDVLQTHPSGAQNGIFSIKLPGSSKIFSVYCDQETSLGGWLLIQQRMDGSLN
FNRTWQDYKRGFGSLNDKGEGEFWLGNDYLHLLTLRGSVLRVELEDWAGKEAYAEYHFRV
GSEAEGYALQVSSYQGTAGDALMEGSVEEGTEYTSHSNMQFSTFDRDADQWEENCAEVYG
GGWWYNSCQAANLNGIYYPGGTYDPRNNSPYEIENGVVWVPFRGADYSLRAVRMKIRPLV
GQ
NT seq 2349 nt NT seq  +upstreamnt  +downstreamnt
atgctttccctgagggtcgcctgcctcatcctgagcttggccagcacagtctggactgca
gacaccggcaccacaagtgaattcatagaagcaggaggagatattcgtggcccaagaatt
gtggagagacagcctagtcaatgcaaggagacagattggcccttctgctctgatgaagac
tggaaccacaaatgcccttcaggctgcaggatgaaagggttgattgatgaagccaatcag
gactttacaaacagaatcaacaagctcaaaaactcactatttgattttcaaaagaacaac
aaggattctaattcactgaccaggaatatcatggagtatttgagaggggacttcgctaac
gccaacaactttgataacactttcgggcaagtgtcagaggacctgaggcgcagaattgag
atcctaaagcgcaaagtcatagagaaagcgcaacagattcaggttctgcagaaagacgtc
cgggatcagctgatagacatgaagcgcctggaggtggacattgatatcaagatccgctct
tgcaaaggatcctgcagcaggtctgtaagccgtgagataaatctaaaggactacgaaggt
cagcaaaagcaacttgaacaggtcattgctaaagagttgcttccggcaaaagacaggcag
tacttgccagcaataaaaatgtctccagttcccgacttggttcccggaagttttaagagc
cagcttcaggaggggcccccagagtggaaggcattaacagaaatgaggcagatgagaatg
gagctggagaggcccgggaaggatggggcttcgcgaggagatttaccaggagattcgcga
ggagactctgcaacacgtggaccagggtcgaagatagaaaaccccatgacccctggacat
ggtgggtctgggtattggcgtcctgggagctccggatctggaagtgatggaaattggggc
tctgggacaacggggtctgatgacactggaacctggggtgcaggaagctccagacctagc
tcaggctctgggaaccttaagcctagcaaccctgactggggtgagttttcagagtttgga
gggagtagcagcccagcgacaagaaaagagtatcacacaggaaaactggtcacttctaaa
ggagataaagagctcctcattggaaacgagaaagttacctctactggcacaagcaccaca
cgtcgttcatgctctaaaaccattactaagactgttttgggtaatgatggtcaccgggaa
gtggtcaaagaagtggtcacttcggatgatggttctgactgcggtgatggcatggactta
ggcctgacccacagttttagtggcagacttgacgaactttcccgaatgcatcctgaactt
ggttccttttatgacagccgctttggttcactcacaagtaacttcaaagaatttggcagt
aagacctctgattctgacatcttcacagacatcgagaaccctagctcccatgtacctgag
ttttcttccagtagtaaaacctcaactgtcaggaaacaagtaaccaagagctataaaatg
gcagatgaggcagcaagtgaagctcaccaagaaggagacactcgaaccaccaagaggggc
cgagctcgcacaatgagagactgcgatgatgtccttcaaacacatccttcaggtgcccaa
aatggcattttcagtatcaagctacctggatccagtaagatattttctgtttattgcgat
caagagaccagtttgggaggatggcttttgatccagcaaagaatggatggatcactgaat
tttaaccggacctggcaagactacaagagaggtttcggcagcctgaatgacaagggggaa
ggagagttctggctaggcaatgactacctccacttactcactctgagaggctctgtcctc
agggttgaattagaggactgggctggaaaagaggcttatgcggagtaccacttccgggta
ggctctgaggcagagggctatgcactgcaggtctcctcctaccagggtaccgctggagat
gctctgatggagggctctgtggaggaggggacagaatacacttcacacagcaacatgcag
ttcagtacctttgacagagatgcagaccaatgggaagagaactgtgccgaggtctacggg
ggaggctggtggtacaatagctgtcaagccgccaatctcaatggcatttactaccctggg
ggcacctatgaccccaggaacaacagtccctatgagatagagaacggagtggtctgggtt
cccttcagaggagcggattattctctgagggccgttcggatgaaaatcagaccgctggtg
ggacagtag

DBGET integrated database retrieval system