KEGG   Rattus norvegicus (rat): 361974Help
Entry
361974            CDS       T01003                                 

Gene name
Gatb, Pet112l
Definition
(RefSeq) glutamyl-tRNA amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00970  Aminoacyl-tRNA biosynthesis
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    361974 (Gatb)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:rno03029]
    361974 (Gatb)
Enzymes [BR:rno01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     361974 (Gatb)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     361974 (Gatb)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    361974 (Gatb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-GeneID: 361974
NCBI-ProteinID: XP_001066526
RGD: 1307864
Ensembl: ENSRNOG00000037655
UniProt: M0R4L6
Position
2q34
AA seq 557 aa AA seqDB search
MAAPVLRSGFPGRRWALAWIDDCSRLRSGSQIGPISNWARRQSSVAQPSLHTAQKPRKGE
HKWAAVVGLEIHAQISSNSKLFSGAQVCFAAPPNSLVSYFDASLPGTLPVLNRRCVEAAV
MAGLALNCHINKKSLFDRKHYFYSDLPAGYQITQQRLPIATNGHLTYSIYLGKKHSQVTT
KTVRIKQIQLEQDSGKSLHDDLRSQTLIDLNRAGIGLLEVVLEPDLCCGEEAALAVRELQ
LILQALGASQANMAEGQLRVDANISVHHPGEALGVRTEVKNLNSLRFLAKAIDYEIQRQI
TELENGGEILNETRSFDYKRGCTMPMRDKEGKQDYRFMPEPNLPPLVLYDDTSVPPDADP
QQVISIDRLRDMLPELPSATRERLVQQYGMLPEHSFALLNEVGLLEFFQNVIKETRAEPK
KVTNWVLNTFLCYLKHQNLAVSESPVTPSALAELLDLLDSKAISSSAAKQVFEELWRGEG
KTAAQIVSEQQLELIQDEEALEELCQATIEGHPQVVMDVKKRNPKAINKLVGLVRKASLS
RADPALIKEILEKKLSL
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atggcggcacccgtgctgcgttcgggtttccctggaagacgctgggctttagcgtggata
gacgactgttcccgcctccgaagtggctctcaaattgggcccatatccaactgggctagg
agacagagttcagtggctcagccttccctccacacggctcagaagccgaggaaaggtgaa
cacaaatgggcagctgtagtaggattggaaattcatgcgcagatttcctccaactctaaa
ctcttctctggagctcaagtatgctttgcagcacctccgaattctttggtttcttatttt
gatgcatctctgcctggaactttaccggttctcaacaggaggtgtgtggaagccgcagtg
atggctggcttagcactgaactgccacataaacaagaagtccttgtttgacaggaagcac
tacttctactcagaccttccggccggctaccagatcacccagcagaggctcccgattgct
accaatggacacttgacctacagtatctatctagggaagaaacacagtcaggtgaccacc
aagacagtgaggatcaagcagatccaactggagcaggacagtggcaaaagcctccatgat
gacctgaggtcgcagacactcattgatttgaacagagctggaattggccttcttgaagtg
gtcctggagcctgacctctgctgtggagaagaggcagccctcgctgtcagggaactgcag
ctgatccttcaagccctgggcgccagccaagccaacatggcagagggtcagctgagagtg
gatgccaatatatcggtacatcatcctggagaagccctgggcgtccggactgaagtaaag
aatctcaacagcctcagattcttggccaaagccatagactatgaaattcagaggcaaatc
accgaacttgaaaatggaggtgaaattctgaatgaaacccgttcatttgattataagcgg
gggtgcaccatgccaatgagagacaaagaagggaaacaagactacaggtttatgccggag
cctaacctgccccccttagtgctctacgatgacacatctgtgccaccagatgcagaccct
cagcaggtgatcagtattgaccggctgagggacatgctcccagagctccccagtgcaacc
agagaaaggcttgtccagcaatatgggatgctgccggagcacagctttgccttactgaat
gaagttggcctactggagttcttccagaatgtgataaaagaaactagggcagagccaaaa
aaggtgactaactgggtcctgaacacttttctgtgctatttaaagcaccagaatctcgca
gtcagtgagagtcctgtcacaccctctgcacttgccgagctcctcgacctgctggacagt
aaagcaatttcttcctcagcagctaagcaggtgtttgaggagctgtggaggggagagggg
aagacagcagcacagatcgtgtcagagcagcagctggagctcatacaggatgaggaggcc
ctggaagaactctgccaggctaccatagagggacacccccaagtggtgatggatgtgaag
aaaaggaaccccaaagccataaataagttggttgggttggtccggaaagcaagcctaagc
cgagcagacccggctctgataaaggagatactggagaagaagctgtcactgtga

DBGET integrated database retrieval system