KEGG   Rattus norvegicus (rat): 361990
Entry
361990            CDS       T01003                                 

Gene name
Chtop, Fop, SRAG
Definition
(RefSeq) similar to DKFZP547E1010 protein
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: FoP_duplication
Other DBs
NCBI-GeneID: 361990
NCBI-ProteinID: NP_001014197
RGD: 1359407
Ensembl: ENSRNOG00000012760
UniProt: Q498T2
Position
2q34
AA seq 202 aa
MAAQSAPKVVLKSTTKMSLNERFTNMLKNKQPMPVNIWASMQQQQQLASARNRRLAQQME
NRPSVQAALKLKQSLKQRLGKSNIQARLGRPIGALARGAIGGRSLPIIQRGLPRGGLRGG
RATRTLLRGGMSLRGRGMIGRGRGGFGGRGRGRGRGRGALTRPVLTKEQLDNQLDAYMSK
TKGHLDAELDAYMAQTDPETND
NT seq 609 nt   +upstreamnt  +downstreamnt
atggctgcacagtcagcgccgaaagttgtgctaaaaagcaccaccaagatgtctctaaat
gagcgctttactaatatgctgaagaacaaacagccgatgccagtgaatatttgggcttcg
atgcagcagcagcagcagctagccagtgccagaaacagaagactggcccagcagatggag
aatagaccctctgtccaggcagcattaaaacttaagcagagcttaaagcagcgcctgggt
aagagtaatatccaggcacggttaggccgacccataggtgctctggccaggggagcaatt
ggaggaagaagccttcccataatccagagaggcttgccccgaggaggactacgtggggga
cgtgccaccagaaccctgcttaggggtgggatgtcgctccgaggtcggggtatgataggt
cggggaagagggggctttggaggcagaggccgaggtcgtggccgagggagaggtgccctc
actcgccctgtattgaccaaggagcagctggacaaccaattggatgcatacatgtcgaaa
actaaaggacacctggatgctgaattggatgcctacatggcacagacagatcctgaaacc
aatgattga

DBGET integrated database retrieval system