KEGG   Rattus norvegicus (rat): 361999Help
Entry
361999            CDS       T01003                                 

Gene name
Anp32e
Definition
(RefSeq) acidic nuclear phosphoprotein 32 family member E
  KO
K18648  acidic leucine-rich nuclear phosphoprotein 32 family member E
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    361999 (Anp32e)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histone chaperones
    Other Histone chaperones and regulators
     361999 (Anp32e)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_9 LRR_4 LRR_8 LRR_6
Motif
Other DBs
NCBI-GeneID: 361999
NCBI-ProteinID: NP_001013218
RGD: 1310611
Ensembl: ENSRNOG00000021168
UniProt: Q5XIE0
Position
2q34
AA seq 258 aa AA seqDB search
MEMKKKINMELKNRAPEEVTELVLDNCLCVNGEIEGLNDTFKELEFLSMANVELSSLARL
PSLNKLRKLELSDNIISGGLEVLAEKCPNLTYLNLSGNKIKDLSTVEALQNLKNLKSLDL
FNCEITNLEDYRESIFELLQQITYLDGFDQEDNEAPDSEEEEEDEDGDEDEEDEEEDEAG
PPEGYEDEDEDEDEAGSEVGEGEEEVGLSYLMKEEIQDEEDDDDYVDEGEEEEEEEEEGP
RGEKRKRDAEDDGEEDDD
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atggagatgaagaagaagattaacatggagttgaagaacagagccccggaggaggtgaca
gagttagtccttgataattgcttgtgtgtcaatggggagatcgaaggcctgaatgacacc
tttaaagaactggagtttctcagtatggccaacgtggagttaagttctttggcccggctt
cccagcttaaacaaacttcggaagttggaacttagtgacaatataatttctggaggcttg
gaagtcctggcagagaaatgtccaaatcttacctacctcaatctgagtggaaacaaaatt
aaagacctcagtacagtagaagctctgcaaaatcttaaaaatttgaaaagtcttgacttg
tttaactgtgagatcacaaacctggaagattacagagaaagtattttcgaactgctgcaa
caaatcacatacttggacggatttgatcaggaggacaatgaagcgcccgactcagaggag
gaggaggaggacgaggatggagatgaggatgaggaagatgaggaagaagatgaagctggt
ccacctgaaggatacgaagatgaggatgaggatgaggatgaagctggctcagaagtagga
gagggagaagaggaggtgggcctctcatacttaatgaaagaagaaattcaggatgaagaa
gacgatgatgattacgttgatgaaggggaggaagaggaagaagaggaagaagagggtcct
cggggagagaaaagaaagcgagatgctgaagatgacggggaggaagatgatgattag

DBGET integrated database retrieval system