KEGG   Rattus norvegicus (rat): 362015
Entry
362015            CDS       T01003                                 

Gene name
Ampd2, Ampd
Definition
(RefSeq) adenosine monophosphate deaminase 2
  KO
K01490  AMP deaminase [EC:3.5.4.6]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00230  Purine metabolism
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    362015 (Ampd2)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.6  AMP deaminase
     362015 (Ampd2)
SSDB
Motif
Pfam: A_deaminase
Other DBs
NCBI-GeneID: 362015
NCBI-ProteinID: NP_001095151
RGD: 2110
Ensembl: ENSRNOG00000019240
UniProt: Q02356
Position
2q34
AA seq 824 aa
MASYPGPGKSKAKYPFKKRASLQASAAAPEARSGLGASPLQSARSLPGTAPCLKHFPLDL
RTSMDGKCKEIAEELFSRSLAESELRSAPYEFPEESPIEQLEERRQRLERQISQDVKLEP
DILLRAKQDFLKTDSDSDLQLYKEQGEGQGDRGLWERDVVLEREFQRVIISGEEKCGVPF
TDLLDAAKSVVRALFIREKYMALSLQSFCPTTRRYLQQLAEKPLETRTYEQSPDTPVSAD
APVHPPALEQHPYEHCEPSTMPGDLGLGLRMVRGVVHVYTRRDPDEHCPEVELPYPDLQE
FVADVNVLMALIINGPIKSFCYRRLQYLSSKFQMHVLLNEMKELAAQKKVPHRDFYNIRK
VDTHIHASSCMNQKHLLRFIKRAMKRHLEEIVHVEQGREQTLREVFESMNLTAYDLSVDT
LDVHADRNTFHRFDKFNAKYNPIGESVLREIFIKTDNKISGKYFAHIIKEVMSDLEESKY
QNAELRLSIYGRSRDEWDKLARWAVNHRVHSPNVRWLVQVPRLFDVYRTKGQLANFQEML
ENIFLPLFEATVHPASHPELHLFLEHVDGFDSVDDESKPENHVFNLESPLPEAWVEEDNP
PYAYYLYYTFANMAMLNHLRRQRGFHTFVLRPHCGEAGPIHHLVSAFMLAENISHGLLLR
KAPVLQYLYYLAQIGIAMSPLSNNSLFLSYHRNPLPEYLSRGLMVSLSTDDPLQFHFTKE
PLMEEYSIATQVWKLSSCDMCELARNSVLMSGFSHKVKSHWLGPNYTKEGPEGNDIRRTN
VPDIRVGYRYETLCQELALITQAVQSEMLETIPEEVGIVMSPGP
NT seq 2475 nt   +upstreamnt  +downstreamnt
atggcatcctatcctggcccaggcaagtccaaggccaaatatccctttaagaagcgggcc
agcctgcaagcttccgctgccgctccagaagctcgaagtggtctgggggcctctccactg
cagtctgcccgatccctgccaggcaccgccccctgccttaagcatttcccgctcgacctt
cgcacgtctatggatggcaaatgcaaggagatcgctgaggagttgttcagccgctcactg
gctgagagtgagctccgtagcgccccttatgagttcccggaggaaagccccatcgagcag
ctagaggagcggaggcagcggctggagcgccagatcagccaggatgtcaagctggagcca
gatattctgcttcgggccaagcaagatttcctgaagacagacagtgattcggacttacag
ctgtacaaggagcaaggagagggacagggggacaggggtctttgggaacgtgatgtggta
ctggaacgggaatttcagcgggtcatcatttctggggaggagaagtgtggggtgccattc
acagacctcttagatgcagccaaaagtgtggttcgagcactgttcatccgggagaagtac
atggccctatcgctgcagagcttctgtcccaccacccgccgttacctgcagcagctggcg
gaaaaacccctggagactcgaacctatgaacagagtcctgatacccctgtgtctgccgat
gccccagtgcacccccctgcgctggaacagcacccatatgagcactgtgagccaagcacc
atgcctggggacctgggcttgggtctgcgcatggtacgtggtgtggtacatgtctacacc
cgcagggaccctgatgagcactgtccagaggtggagcttccataccctgacctacaggaa
tttgtagctgatgtcaatgtgctgatggccctgattatcaatggtcccataaagtcattc
tgctaccgccggcttcagtacctgagctccaagttccagatgcacgttttgctcaatgag
atgaaggagctggctgctcagaagaaagtgccacaccgggacttctacaatatccgtaag
gtggacacacacatccatgcctcgtcctgcatgaaccagaagcatctgctgcgcttcatc
aagcgggcgatgaagcggcatctggaggagatcgtgcatgtggagcagggccgagagcag
acgctgcgagaagtcttcgagagcatgaacctcactgcctacgacttaagtgtggacacg
ctggatgtgcacgcggacaggaatacctttcatcgatttgacaaattcaatgccaaatac
aaccctattggggagtctgtcctccgagagatcttcataaaaactgacaacaagatttct
gggaagtactttgctcacatcatcaaggaggtgatgtcagacctggaggagagcaaatac
cagaatgcagagctccggctgtccatctacgggcgttcgagagacgagtgggacaagctg
gcccgctgggcagtgaaccacagagtgcactcgcccaatgtccgctggctggtgcaggtg
ccccgcctctttgatgtataccgcaccaagggccagctggccaacttccaagagatgctg
gagaacatcttcctgccactgtttgaagctactgtgcaccctgccagccacccagagctg
cacctcttcctggagcatgtggatggttttgacagtgtggatgatgagtctaagccagag
aaccatgtcttcaacctggaaagtcccctcccagaagcttgggtggaggaggataaccct
ccctatgcctactacctgtattacaccttcgctaacatggccatgctgaaccatctgcgc
aggcagagaggtttccacacgtttgtgctgaggccccactgtggggaggctgggcccatc
caccacctggtatcagccttcatgctggccgagaacatctcccacgggctgcttctgcga
aaggcccctgtcctgcagtacctgtattacctggctcagattggcattgccatgtcccca
ctcagcaacaacagcctgttcctcagctaccaccggaaccctctacctgagtacttgtcc
cgtggcctcatggtctcgctgtccacggatgaccccttgcagttccacttcaccaaggag
cccctgatggaggagtacagcatcgccacccaggtgtggaagctcagctcctgtgatatg
tgtgagctggcccgaaacagtgtgctcatgagcggcttctctcacaaggtgaagagccac
tggctgggacccaactataccaaggagggccctgagggtaacgacatccgccgcaccaat
gtgccggacatccgagtaggctaccgctacgagaccctgtgccaggagctggcgctgatc
acacaggccgtccaaagtgagatgctggagaccatcccagaggaagtgggcattgtcatg
agccctgggccgtag

DBGET integrated database retrieval system