KEGG   Rattus norvegicus (rat): 362018
Entry
362018            CDS       T01003                                 

Gene name
Sypl2
Definition
(RefSeq) synaptophysin-like protein 2
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: MARVEL
Other DBs
NCBI-GeneID: 362018
NCBI-ProteinID: NP_001102033
RGD: 1309907
Ensembl: ENSRNOG00000019780
UniProt: D4A6M0
Position
2
AA seq 264 aa
MSSTESPGRTSDKSPRQQVDRLLLGLRWQRLEEPLGFIKVLQWLFAIFAFGSCGSYSGET
GALVRCNNDPKDVSSIIVLFGYPFRLYQVQYEMPLCDEESTSKTMNLMGDFSAPAEFFVT
LGIFSFFYTMAALVIYLRFHKVYTENKRFPLVDFCVTVSFTFFWLVAAAAWGKGLTDVKG
ATRPSSLTAAMSVCHGEEAVCSAGATPSMGLANISVLFGFINFFLWAGNCWFVFKETPWH
GQGQDQGQGPSQESAAEQGAVEKQ
NT seq 795 nt   +upstreamnt  +downstreamnt
atgtcctcgacggagagccccggccgcacctcggacaagtctccgcgccagcaggtggac
cgcctgctcctggggctgcgctggcagcgcctggaggagccgctgggcttcatcaaagtt
ctccagtggctctttgctattttcgccttcgggtcctgcggctcttacagcggggagacg
ggagccttggttcgctgcaacaacgaccccaaggacgtgagctccatcattgttttgttc
ggctatcccttcaggttgtaccaggtccagtatgagatgcctctctgtgatgaggaatcc
acatccaaaaccatgaacctcatgggagacttctctgcccccgccgagttctttgtgacc
cttggcatcttttccttcttctatacaatggctgccctggtcatctacctgcgcttccac
aaagtctacacggagaacaaacgcttcccattggtggatttctgtgtgaccgtctctttc
accttcttttggctggttgctgccgctgcctggggcaagggcttgactgatgtcaaaggg
gccacacggccatccagcctgactgcagccatgtctgtgtgccatggagaggaggcagtg
tgcagtgctggggccacgccctctatggggctggctaacatctctgtgctctttggcttt
atcaacttcttcctgtgggctggaaactgttggtttgtgttcaaagagaccccatggcac
ggacaaggccaggaccagggccagggccccagccaggagagtgcagcagaacagggagcg
gtggagaagcagtaa

DBGET integrated database retrieval system