KEGG   Rattus norvegicus (rat): 362051
Entry
362051            CDS       T01003                                 

Gene name
Lmo4
Definition
(RefSeq) LIM domain only 4
  KO
K24099  LIM domain transcription factor LMO4
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:rno04990]
    362051 (Lmo4)
Domain-containing proteins not elsewhere classified [BR:rno04990]
 LIM domain-containing proteins
  Nuclear LMO family proteins
   362051 (Lmo4)
SSDB
Motif
Pfam: LIM DUF678 Arc_trans_TRASH zf_UBZ
Other DBs
NCBI-GeneID: 362051
NCBI-ProteinID: NP_001009708
RGD: 1305670
Ensembl: ENSRNOG00000009205
UniProt: Q5PPG8
Position
2q44
AA seq 165 aa
MVNPGSSSQPPPVTAGSLSWKRCAGCGGKIADRFLLYAMDSYWHSRCLKCSCCQAQLGDI
GTSCYTKSGMILCRNDYIRLFGNSGACSACGQSIPASELVMRAQGNVYHLKCFTCSTCRN
RLVPGDRFHYINGSLFCEHDRPTALINGHLNSLQSNPLLPDQKVC
NT seq 498 nt   +upstreamnt  +downstreamnt
atggtgaatccgggcagcagctcgcagccgcccccggtgacggccggctccctctcctgg
aagcgctgcgcaggctgcgggggcaagattgcggaccgctttctgctctatgccatggac
agctactggcacagccgctgcctcaagtgctcctgctgccaggcgcagctgggcgacatc
ggcacgtcctgttacaccaagagcggcatgatcctttgcagaaatgactacattaggtta
tttgggaacagtggtgcctgcagtgcctgtggacagtcgattcctgcgagtgaactcgtc
atgagggctcaaggcaacgtgtatcatctcaagtgttttacatgctctacctgccggaat
cgcctagtcccgggagatcggtttcactacatcaatggcagtttattttgtgaacatgat
agacccacagctctcatcaacggccatttgaactcacttcagagcaatccactactgcca
gaccagaaggtctgctga

DBGET integrated database retrieval system