KEGG   Rattus norvegicus (rat): 362077Help
Entry
362077            CDS       T01003                                 

Gene name
Il1f10
Definition
(RefSeq) interleukin 1 family member 10
  KO
K05488  interleukin 1 family member 10
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    362077 (Il1f10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    362077 (Il1f10)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Interleukins
   362077 (Il1f10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL1
Motif
Other DBs
NCBI-GeneID: 362077
NCBI-ProteinID: NP_001102041
RGD: 1305635
Ensembl: ENSRNOG00000005800
UniProt: D4A9I5
Position
3p13
AA seq 152 aa AA seqDB search
MCSLPMARYYIIKDAYQKALYTRNGQLLVGDPDSENCEPEKVCVLPNRGLDRSKVPIFLG
IQGGSCCLACVKTREGPLLQLEDVNIEDLYKGGEQTTRFTFFQRSLGSAFRLEAAACPGW
FLCGPAEPQQPVQLIQESEPSTRTEFYFEQSR
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atgtgttctcttcccatggcaagatactacataatcaaagatgcatatcaaaaggctttg
tacacacggaatggccagctcctggtgggagaccctgattcagaaaactgtgagccagag
aaggtctgtgtccttcctaaccgaggcctggaccgctccaaggtccccatcttcctgggg
atccagggaggaagttgctgcctggcgtgtgtgaagacaagagaggggcctctcctgcag
ttggaggatgtgaacatcgaggacctttacaagggaggtgaacaaaccacccggttcacc
tttttccagagaagcttaggctctgcctttaggctcgaggctgctgcctgccctggctgg
tttctctgtggcccagccgagccccagcagccagtgcagctcatccaagagagtgaacct
tctacccgtactgaattttactttgagcagagtcggtag

DBGET integrated database retrieval system