KEGG   Rattus norvegicus (rat): 362081Help
Entry
362081            CDS       T01003                                 

Gene name
Fbxw5
Definition
(RefSeq) F-box and WD repeat domain containing 5
  KO
K10263  F-box and WD-40 domain protein 5
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    362081 (Fbxw5)
   03036 Chromosome and associated proteins [BR:rno03036]
    362081 (Fbxw5)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     362081 (Fbxw5)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     362081 (Fbxw5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 F-box-like F-box
Motif
Other DBs
NCBI-GeneID: 362081
NCBI-ProteinID: NP_001020901
RGD: 1305661
Ensembl: ENSRNOG00000028674
UniProt: Q4KLI9
Position
3p13
AA seq 569 aa AA seqDB search
MDEGGMPLLPDSLVYQIFLSLGPADVLAAGLVCRQWQAVSRDEFLWREQFYRYYQVARDV
PRHPAATSWYEEFRRLYDMVPCVEVQTLKEHTDQVLHLSFSHSGYQFASCSKDCTVKIWN
NDLTISLLHSADMRPYNWSYTQFSQFNQDDSLLLASGVFLGPHNSSSGEIAVISLDSFAL
LSRVRNKPYDVFGCWLTETSLISGNLHRIGDVTSCSVLWLNNAFQDVESENVNVVKRLFK
IQNLNASTIRTVMVADCSRFDSPDLLLDAGDQAGLPCRVFDLGGDTEEEATDPGLHTSGS
GHVKEGLRRVFDSVLDGHGQLSDCALETKVAELLAQGHTKPPECPDADSRNKYLIFTTGC
LTYSPHQIGIKQILPHQMTTAGPVLGEGRGSDAFFDALDHVIDVHGHIIGMGLSPDNRYL
YVNSRAWPPGSVVADPMQPPPIAEEIDLLVFDLKTMREVKRALRAHRAYTPNDECFFIFL
DVSRDFVASGAEDRHGYIWDRHYNICLAKLRHEDVVNSVAFSPQEQELLLTASDDATIKA
WRSPRIVRVLQAPHPRPRPFFSWFASHRR
NT seq 1710 nt NT seq  +upstreamnt  +downstreamnt
atggatgaggggggcatgcccctgctccccgacagcctggtctaccagatcttcctgagc
ttgggccctgcagatgtgctggctgctgggctggtgtgccgccagtggcaggctgtctcc
cgggacgagttcctatggagggagcagttctaccgctactaccaggtggctcgcgatgtg
ccccgccacccagcggccacatcctggtatgaggagttccggcggctctatgacatggtg
ccctgtgtggaggtgcagacactgaaggagcacaccgaccaggtcctgcacctcagcttc
tcccactcggggtaccagtttgcctcctgctccaaggactgcacagtgaagatctggaac
aatgacctgaccatctctctgctgcacagtgcagatatgaggccatacaactggagttac
acccagttctcccagttcaaccaggatgactcactgttgctggcctcgggggtgttccta
gggccacataactcctcctcaggcgagatagctgtcatcagcttagactccttcgccctg
ctgtcgcgtgtgcgaaacaagccctatgatgtgtttggctgctggctcacagaaaccagc
ctcatctcggggaacctgcaccgcattggagatgtcacctcctgctcagtgctgtggctc
aacaatgccttccaggatgtggagtcagagaacgtcaacgtggtaaagcggctctttaag
atccagaacctcaatgccagcaccatccgcaccgtgatggtggctgactgcagccgcttt
gatagcccggacctcctgctggatgctggtgaccaggctgggctcccctgccgagtcttt
gacctaggtggggacactgaagaagaggccactgacccaggtttgcacacctctggttct
ggccatgtcaaggaaggtttacggcgtgtgtttgatagcgtcctggatggacatggacag
ctgtcagattgtgcactggagaccaaggtggctgagctgctggcccagggccacaccaag
cccccagagtgtcctgacgctgacagcaggaacaagtacctcatcttcaccactggctgc
ctcacgtactcacctcatcagatcggcatcaagcagatcctgccgcaccagatgacaact
gcagggcccgtgctgggcgagggccggggctctgatgccttctttgatgccctggaccat
gtcattgatgtgcatgggcacatcattggcatgggcctgtctcccgataacaggtacctg
tatgtgaatagccgtgcctggccccctggctcagtggtcgccgaccccatgcagccacca
cccattgcagaggagattgacttgctggtgtttgatctgaagaccatgcgggaggtgaag
cgagctctgcgagcacaccgtgcctacacacccaatgatgagtgcttcttcatctttctg
gatgtcagcagggattttgtggccagtggggctgaagatcggcatggctatatctgggac
cgccactacaacatctgcctagccaagctgcggcatgaggatgtggtcaactcagtggcc
tttagcccccaggagcaggagctcttgttgacagccagcgatgatgccactatcaaagcc
tggcgctcaccacgcattgttcgtgtcctgcaggctccacacccacgcccacgccccttc
ttctcctggtttgccagccataggcgctga

DBGET integrated database retrieval system