KEGG   Rattus norvegicus (rat): 362083Help
Entry
362083            CDS       T01003                                 

Gene name
RGD1560470
Definition
(RefSeq) similar to Gene model 996
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: zf-MYND ALF
Motif
Other DBs
NCBI-GeneID: 362083
NCBI-ProteinID: XP_006224375
RGD: 1560470
Ensembl: ENSRNOG00000033863
UniProt: D3ZTF0
Position
3p13
AA seq 974 aa AA seqDB search
MTRTDPPDLLVSTVYQDIKVVDPGLTSKRQPCERSVARPAASTPFNKRHCRSFDFLEALD
EPTMETHPEPPPPEPAPPRARPRDGEPRRRTRSKSAPRVPQSLTTAPASPPVLQRRGREA
QRAVRVEGSPCREPSYPALRALANELHPIKLQPQRGGPGRIAPLCATPGRCAPPESSAGP
VPHVRCRLDIKPDEAVLQHAARSSRSGAPRETSSWARTVPQFHGLTVPGPRHVALSRTPT
PSDLYCTDPRPLYCDGPLPGPRDYLEHRTQPFTTPPGPTQFFYTEEPEGYAGSFTASPGL
PFDGYCSRPYLSEEPPRPSPRRGGSYYAGEVRTFPIQEPPSRSYYGETTRAYGLPFVPRY
VPEEPRVHPGARAFYTEDFGRYRERDALARTYPHPRSSPTWADWGPRPYRTLQVMPPPAP
GPLLASWHGGTGTSPPRLVTDSRHYSRSWDNILAPGPRREDPLGRGRSYENLLGREVRDT
RGSSPEGRRPPVVVNLSTSPRRYAALSLSETSLTEKGRTGECLGRNWYVTPEITITDNDL
RSAERPTAKGWELPGGRPRQPVPVVPEGPASSRQRSLEQLDELITDLVIDSRSPAQAPEP
TAEGLGRQLRRLLDSRPAGPGGATALAPSRSPPASAGSTEEPTGSGEAAEASPEPSADED
DLMTCSNARCRRTETMFNACLYFKSCHSCYTYYCSRLCRREDWDAHKARCVYGRVGSVCR
HVLQFCRDSSPVHRAFSRIARVGFLSRGRGVLFLGFPSPGSADNFLRFGLEGLLLSPTYL
SLRELATHAAPLGSYARELAAAGRLYEPAECFLLSVSVAVGPGAAPPGAAARPAPRSPGP
TVRKFAKVALAAGSPTRPPPARGGEPDMETLILTPPPGTAGLDEEGEAGRRAREVAFIHI
QRELRLRGVFLRHEFPRVYEQLCEFVEANRRFTPTTIYPTDRRTGRPFMCMIMAASEPRA
LDWVASANLLDDIM
NT seq 2925 nt NT seq  +upstreamnt  +downstreamnt
atgacccgcacggacccgccggacttgctggtgtcgaccgtgtaccaggacatcaaggtg
gtggacccagggctcacgtccaaacgccagccatgtgagcgatccgtggcccggcctgct
gcgtccactcctttcaacaagcgccactgccgtagctttgacttcttagaagcactggac
gagcccaccatggagacacacccagagccgccacctcctgaacctgcgccaccgcgcgcc
cggcccagagacggcgagcctcggcgtcgcacccgttccaagagcgcgccccgtgtgccc
caaagcctgacgactgctccggcttcaccgcccgtactgcagcgcagaggccgggaagcc
cagcgtgccgtacgggtggaggggtcgccgtgccgggagccctcgtaccctgcgctgcga
gctcttgctaatgaactgcaccctatcaagctccagccacagcggggaggccccggacgc
atcgcgcctctatgcgccaccccaggccgctgcgcaccaccagaatcatctgctggaccc
gtcccccatgtccgctgccgtttggacataaagccggacgaggcggtgctgcagcacgcc
gcccgaagctcgcgatctggcgcacctagagagacgtcgtcctgggctcgcaccgtccca
cagttccatggactcacagttcccggccctcgccatgtggccctgtcacgcactcccacc
cccagtgacttgtactgtactgaccccagaccactgtactgcgatgggccgctgcctggg
cctcgggactacttggagcaccgcactcaacccttcacaactcctccaggtcccacccaa
tttttctacaccgaggagccagaaggctacgcaggcagttttactgcaagccccggcctt
ccctttgatggctactgttctaggccctacttgtccgaagaaccccctagacccagtcca
aggcgtgggggcagctactatgctggcgaagtgcgcaccttcccgatccaggagcccccc
tcccgctcctactacggggagacaactcgagcctatggtctgcctttcgttccccggtat
gttccagaagagccccgggtgcacccaggagcccgcgccttctacacagaggactttggg
aggtaccgcgaacgcgatgcactggctcggacttacccgcatccacgcagcagcccaacc
tgggctgactggggtccgaggccttaccgcacccttcaggtgatgccgcctcctgcccct
ggaccactgttggcctcgtggcacggtggcactggcacaagcccaccccggctggttacc
gatagccgccactactctcgatcctgggacaacatcctagctcctggtcctcgtcgtgaa
gaccctctaggacgtggccgcagctatgagaacctcctgggacgcgaagttcgggatacg
cggggttcatcccctgaaggaaggcgtccaccagtcgtagtgaatctgtccacctcaccc
agacgctatgcagcactctcgctgtccgagacgtcgctgacagagaaaggccgcacggga
gagtgcctgggccgcaactggtatgtcacgccagagattaccatcacagacaacgacctt
cgctcagcagagcgcccgactgccaagggctgggaattgcctggaggccgaccacggcag
cccgtacccgtggtccctgagggtcccgcttccagccgccagcgcagcctcgagcagctg
gacgagctcatcaccgacctggtcatcgactcacgatcgccagcccaggccccagagcct
acggccgaaggtttaggccgccaactacgccgcctgctggactcacggcctgcgggccct
ggaggagccaccgcgctggcgccgtcgcgctcgcctccggcctcggctggcagcacagaa
gagcccaccggctcgggggaggcagccgaggcctccccagagcccagcgcagatgaggat
gacttgatgacctgctccaacgcgcgctgccggcggacagagaccatgttcaacgcctgc
ctctacttcaagtcatgccacagctgctatacctactactgctcgcgtttgtgccgccga
gaggactgggatgcgcacaaggcgcgttgcgtgtacggccgcgtgggcagcgtgtgccgc
cacgtgttgcagttctgccgcgacagcagcccagtgcatcgcgccttctcgcgcatagcg
cgcgtcggattcctgtcgcgaggccgtggcgtgctgttcttaggctttccgagcccgggc
tctgccgacaactttctccgcttcggcctcgaagggctgctgctatcgcccacctacctg
tcgctgcgtgagctggctacacatgcggcgcccctgggtagctatgcacgagagctggcg
gccgccgggaggctctatgagccggcggagtgcttcctgcttagcgtgtccgtggccgtg
ggccccggcgctgcacccccgggagccgctgcccggcccgcgccacgcagtcctgggccc
acagtgcgcaagttcgccaaggtagccctggccgctggcagcccgacgcggcctcctcct
gcgcgtggcggagagccagacatggaaacgttgatcctgacgccaccccccggcactgcg
ggcctggacgaagagggtgaagccggccggcgcgcgcgtgaagtagccttcatccatatc
caacgtgagctgcgactgcgcggcgtctttctccgccacgagttcccacgggtctacgag
cagctctgtgagtttgtggaggctaaccggcgcttcacgcccacaaccatctatcccacg
gatcggcgcacaggccgccccttcatgtgcatgatcatggctgcttccgagccgcgtgca
ctagattgggtagccagtgccaacctgctggacgacatcatgtga

DBGET integrated database retrieval system