KEGG   Rattus norvegicus (rat): 362085Help
Entry
362085            CDS       T01003                                 

Gene name
Sohlh1, RGD1564440
Definition
(RefSeq) spermatogenesis and oogenesis specific basic helix-loop-helix 1
  KO
K22495  spermatogenesis- and oogenesis-specific basic helix-loop-helix-containing protein 1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    362085 (Sohlh1)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   HLH domain only
    362085 (Sohlh1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HLH
Motif
Other DBs
NCBI-GeneID: 362085
NCBI-ProteinID: NP_001178781
RGD: 1564440
Ensembl: ENSRNOG00000033983
UniProt: D4A4L1
Position
3p13
AA seq 357 aa AA seqDB search
MASGGHERATEDYGVSDITGCSKTPQTETQENLETPSQSSALCPAPVAAANWSPCLRRNV
VSERERRRRISLSCERLRALLPQFDGRREDMASVLEMSVCFLQLAHSMDPSWEQLSVPQP
PQEMWHMWQGDVLQVTLANQIADSKPDSGIAKASAVARVQDPPCCGMLDTDQSQATERAS
ELLERPSSCPGKSQSSLSFSESESSSLGAGLPPWPPHSWQPATPEASDAVSGGSQQVGSL
AGDTESPGMLAEEANLVLASVPDARYTTGAGSEVVDGASFLLTTNPDWWLGSVEGRGGPA
LARNSPVDGAEPIYIGDPEPCSQELQAGPVELWGLDFGSPGLALKDEADSIFPDFFP
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccggtggccacgagcgggctactgaggattacggagtctccgacattacggga
tgcagcaagactcctcagactgagactcaggagaacttggagactccctcacaaagctca
gccctctgcccagctcctgtggctgctgcaaattggagcccctgtcttcggagaaacgtg
gtcagcgagagagaacgcaggaggaggatctccttgagctgtgagcgcttgcgggcacta
ctgcctcagtttgatggccgtcgggaggacatggcttccgtcctggagatgtctgtgtgt
ttcctccagcttgcccacagcatggatcctagctgggagcagctctctgttcctcagcct
cctcaagagatgtggcacatgtggcagggcgatgttctgcaggtaacccttgcgaatcag
attgcagacagcaagccagactccgggatagcaaaagcatctgccgtggctcgggtgcag
gaccccccatgctgtggcatgctggatacagaccagagccaagctactgagagggcgtcg
gagcttctggagaggccttcctcctgccctggtaagagccagagctccttgtcattcagt
gagtcagagtcctccagcttgggtgctgggctcccaccctggcctcctcactcatggcag
ccagccactcccgaggcgagtgacgctgtttctggtggatcacagcaggtgggatccctg
gccggggacactgagtctccgggcatgctggctgaggaggccaacttggtcttggcatct
gtgcctgatgccaggtacaccacaggggcagggtccgaagtggtggacggagcatccttt
ctgctgaccaccaatcctgattggtggttggggtcagtggagggcagaggaggaccagct
cttgccaggaacagcccagtggatggggcagagccaatctacattggagaccctgagccc
tgctcccaggagctccaggctggccccgtagagctgtggggcttggattttggcagccct
ggcctggccctgaaggatgaagcagacagcatcttccctgactttttcccctga

DBGET integrated database retrieval system