KEGG   Rattus norvegicus (rat): 362098
Entry
362098            CDS       T01003                                 

Gene name
Gle1
Definition
(RefSeq) nucleoporin GLE1
  KO
K18723  nucleoporin GLE1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03013  RNA transport
rno03015  mRNA surveillance pathway
rno05014  Amyotrophic lateral sclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    362098 (Gle1)
   03015 mRNA surveillance pathway
    362098 (Gle1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    362098 (Gle1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    362098 (Gle1)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     362098 (Gle1)
SSDB
Motif
Pfam: GLE1
Other DBs
NCBI-GeneID: 362098
NCBI-ProteinID: NP_001020902
RGD: 1307329
Ensembl: ENSRNOG00000015237
UniProt: Q4KLN4
Position
3
AA seq 698 aa
MPSDGRCWETLRALRNSSKGRLRYDREWLLRYEDVLEECMSLPKLSSYSGWVVDHILPNT
SHHTQENAPSSDNSPSSGSASGLYQSTLKSPVRSSPQSPSPSTPSGTQSAHESPFTEPIA
LQSSRAIKVEGCIRMYELAHRMRGTEGLRQWQEEQERKVQALSEMASEQLKRFDELKELK
LHKEFRDLQEVMEKSTREALGHQEKLKAEHRHRAKILNLKLREAEQQRVKQAEQEQLRKE
EGQIRLRSLYTLQEEVLQLNQQLDASSQHKDLLNVDLAAFQTRGNQLCGLISGIIRTTLE
SGYPTAENQAEAERVLQEMRDLLSNLEQEITRASEMKKKDEEEARVKLQESQVQQGPGAP
TKTSAPSPSLVGTQSEDLQVKVQDSTMQWYQQLQDASAKCVLAFEDLTSSKDSQIKKIKM
DLQKAATIPVSQISTIAGSKLKEVFDKIHSLLSGKPVQSGGRSVCVTLNPQGLDFVQYKL
AEKFVKQGEEEVASHHEAAFPIAVVASGIWMLHPKVGDLILAHLHKKCPYSVPFYPAFKE
GMPLEDYQRMLGYQVTDSKVEQQDNFLKRMSGMIRLYAAIIQLQWPYGSRQEAHPHGLNH
GWRWLAQILNMEPLSDVTATLLFDFLEVCGNALMKQYQVQFWKMILLIKEDYFPRIEAIT
SSGQMGSFIRLKQFLEKCLQRREIPVPKGFLTPSFWRS
NT seq 2097 nt   +upstreamnt  +downstreamnt
atgccgtctgatggtcgctgctgggaaactctgagggcgctccgcaattccagcaaaggc
cgcctgcgctacgaccgcgagtggttactgcgctacgaggatgttttggaagaatgtatg
tctcttcccaaactatcttcttactctggatgggtggtggatcacatcctacccaacacc
tcacaccacacgcaagagaatgctccttcctctgataattcaccatcctctggatctgct
tcaggcctgtaccaatccacacttaagtctcctgtcagaagtagcccacaatctccttca
ccctcaacaccaagtggaacccagagcgcacatgagtccccgttcacagaacctattgca
cttcagtcctcccgagcgatcaaagtggaaggttgcatccgaatgtatgaattggcgcac
agaatgagaggaacagagggcctgaggcagtggcaggaggagcaagagaggaaggtgcaa
gccctctcagagatggcgtccgaacagctgaagaggtttgacgagctgaaggagctgaag
ctgcataaggagttccgggacttacaggaagtgatggagaagagtaccagagaagccctg
ggccatcaggagaagctgaaagctgagcatcgccacagagccaagattctcaacctaaag
cttcgagaggcagagcagcagcgtgtgaagcaggcagagcaggagcagctgcggaaggag
gaaggccagatccgtctgcgcagcctgtacaccctgcaagaggaggtcctgcagctcaac
cagcagctggatgcttccagtcagcacaaagacctgctgaatgtggacctggctgctttc
cagacccggggcaaccagctgtgtggcctcatctctggcatcattcgcaccaccttggag
agtggctatcccacagcagagaaccaagctgaggctgagcgagtcctgcaggaaatgcgg
gacctcctctcaaatttggagcaggagatcaccagagcctctgaaatgaagaagaaagat
gaagaagaggctcgggtcaagctgcaggagtcacaggtgcagcaggggccaggggctccc
accaagacctctgcacccagcccaagcctagtagggacacagagtgaagacctgcaggtg
aaggtacaggatagtacgatgcagtggtaccagcaacttcaggatgcttctgccaaatgc
gtgttggcctttgaggacctgaccagcagcaaggacagtcagatcaaaaagataaagatg
gacctgcagaaggcagccaccatcccagtgagccagatctccaccatcgcaggttccaag
ctgaaggaggtttttgacaagatccacagcctgctctctggaaagcctgtccagtctggt
ggacgttctgtgtgcgtcactcttaacccacaggggttggactttgtccagtacaaactg
gccgagaaatttgtgaaacaaggggaggaggaagtggcctctcaccacgaagcagccttc
cccattgcagtggtggcctctggtatctggatgctccaccccaaagtgggagacctcatt
cttgcccacctccacaagaagtgtccgtactccgttcctttctacccagctttcaaggag
gggatgcctctggaggattatcaacggatgcttggctaccaagtgacggattccaaggtt
gagcaacaggacaactttctaaaacgaatgtctgggatgatccgtttgtatgccgccatc
atccagctccagtggccatatggaagccggcaggaggctcatcctcacggcttaaatcat
ggctggcgctggttggcgcagatcttaaacatggagcctctctcagatgtgacagccact
ctcctgtttgacttcttggaggtgtgtgggaatgccctcatgaagcagtaccaggtccag
ttctggaagatgatccttctcatcaaagaggactacttccccagaattgaagccatcacg
agctcaggacagatgggttccttcatacgtctgaagcagttcttggagaaatgtctgcaa
cgcagggagatccctgtccctaaaggctttctgacgccctccttctggcgctcttga

KEGG   Rattus norvegicus (rat): 500697
Entry
500697            CDS       T01003                                 

Gene name
RGD1565693
Definition
(RefSeq) nucleoporin GLE1-like
  KO
K18723  nucleoporin GLE1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03013  RNA transport
rno03015  mRNA surveillance pathway
rno05014  Amyotrophic lateral sclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    500697 (RGD1565693)
   03015 mRNA surveillance pathway
    500697 (RGD1565693)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    500697 (RGD1565693)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    500697 (RGD1565693)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     500697 (RGD1565693)
SSDB
Motif
Pfam: GLE1 Spc110_C
Other DBs
NCBI-GeneID: 500697
NCBI-ProteinID: XP_038968961
RGD: 1565693
Position
6
AA seq 706 aa
MVPVPTRSRPSGGRCWKTLRALRDSSRGSLHLQAKGLRSSREGGRSLAKLSSDLGWVVDD
IPPDSSGHSADEAPPWDNSPSSGSASGLQGPSLLESPRTSTPQSPSPSRASGTQSTRESL
FTDPMALQCSRAIGVEACLRMYQLASRRRAAEGLRWWQEEQEKKVRALSEMVCQQLERFD
QLREQKLQKDFRDFQDRMEKGRREALGRQRKLRAEQGLRAKLLALKLGEVEQQQRQKQAE
QEPISLEEGQVPVLGLCTLQEEVLRLNRQLEASVQQHRDLLNVDLSAFQSRGTQLCAFIS
GLLPTTLDTGYPTAENQAEAEGALQEMRDLLFHLEQEISRATEMKEEEEARIKQQESQGP
NHLRGPAWTSAPQPKPSRDSGEKDPHLQVQDRKTTQWYQRLQDASAKCELAFEDLSSSKD
SQDRRIKMDLQKAATIPVSQISSSAGSKLKEVFDKLHSLLSGQPVQSGGRPVSVSLHPQG
LDFVQYKVAEKLVKQGESEVASHPEAAFPIAAVASGIWMLHPRVGDLILAQLHRQCPYSV
PFHPAFKEGMALEDYGRMLGYPVTHSKVEEQDHFLKRMSGMIRFYAAIIQLQWPYGDRQE
AHPHGLQHGWRWLAQVLNLEPLPHVTATLLFDFLEVCGNALVKQYQVQFWKLVLVIREDY
LPRIEAITSSGQMGSLVRLQQFLDKCLQRREIPVPRGFLTASFWNS
NT seq 2121 nt   +upstreamnt  +downstreamnt
atggtgccggtgcccaccaggtcaaggccttcgggtggtcgctgctggaaaacgctgagg
gcgctccgtgactccagcagaggaagcctgcacctacaggccaaggggctgaggagctcc
cgagaaggaggcaggtctcttgccaaactttcttctgacttgggctgggtggtagatgac
atcccaccggacagctcaggccactctgcagacgaggctcctccctgggataattcaccc
tcctctggatctgcttcaggcctgcagggaccctcgctcctcgagtctccccgcacgagt
accccgcaaagcccctcaccctcaagagcaagtggaacccagagcacgcgtgagtccctg
ttcacagaccctatggcgcttcagtgctctcgggccatcggagtggaggcctgcctccga
atgtaccaattggccagcagaaggagagcagcagagggcctgaggtggtggcaggaggag
caagagaagaaggtgcgagccctctcagagatggtatgccaacagctggagaggtttgac
cagctgagggagcagaagctgcagaaggacttccgggacttccaggacaggatggagaag
ggtcgcagagaagccctgggccgtcagagaaagctgagagctgagcagggcctcagagcc
aagcttctcgccctaaagcttggagaggtagagcagcagcagcgccagaagcaggcagag
caggagccgataagcctggaggaaggccaggtccctgtgcttggcctgtgcaccctgcaa
gaggaggtcctgcggctcaaccggcagctggaggcctcggttcagcagcacagagacctc
ctgaacgtggacctgtctgccttccagagccggggcacgcagctgtgcgccttcatctcc
ggactccttcccaccaccttggacactggctatcccacagcagagaaccaagctgaggct
gagggagccctgcaggaaatgagggacctcctcttccatttagagcaggagatctccaga
gccaccgaaatgaaggaggaggaggaggcccgcatcaagcaacaggagtcacagggcccc
aatcacctgaggggtcctgcctggacctctgccccccagcccaagcccagcagggactca
ggcgaaaaagacccgcacctgcaggtccaggacaggaagaccacacagtggtaccagcga
cttcaggatgcttctgccaaatgcgagttggcctttgaggacctgagcagcagcaaggac
agtcaggacagaaggatcaagatggacttgcagaaggcagccaccatcccagtgagtcag
atctccagcagcgcaggttcaaagctcaaggaggtcttcgacaaactccacagcctgctc
tctggacagcctgtgcaatctggtgggcgtcccgtgtctgtcagtcttcaccctcagggg
ctggactttgtccagtacaaagtggcagagaaattggtcaagcaaggggagtcggaagtg
gcctctcaccccgaagcggccttccccattgcggccgtggcctctgggatctggatgctc
caccccagagtgggagacctcatcctcgctcagctccacaggcagtgtccctactccgtt
cctttccaccctgctttcaaggaagggatggctttggaggattatggacggatgcttggc
tacccagtgacacattccaaggtggaggaacaagaccactttctgaaacggatgtccggg
atgatccgtttctatgccgccatcatccagctccagtggccatatggagaccggcaggag
gctcaccctcacggcttacagcatggctggcgctggttggcacaggtcttgaacctggag
cctctcccgcatgtgacagccactctcctctttgacttcctggaggtgtgtggcaatgcc
ctggtgaaacagtaccaggtccagttctggaagctggtccttgtcatcagagaggactac
ctgcccagaattgaagccatcaccagctcaggacagatgggctctctagtgcgtctgcag
cagttcttggacaaatgtctgcagcgcagggagatccctgtccccagaggttttctgaca
gcctccttctggaactcttga

DBGET integrated database retrieval system