KEGG   Rattus norvegicus (rat): 362102Help
Entry
362102            CDS       T01003                                 

Gene name
Ptpa, Ppp2r4
Definition
(RefSeq) protein phosphatase 2 phosphatase activator
  KO
K17605  serine/threonine-protein phosphatase 2A activator
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04931  Insulin resistance
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    362102 (Ptpa)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    362102 (Ptpa)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Other PP2-interacting proteins
     362102 (Ptpa)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PTPA
Motif
Other DBs
NCBI-GeneID: 362102
NCBI-ProteinID: NP_001102047
RGD: 1308354
Ensembl: ENSRNOG00000018457
UniProt: B2RYQ2
Position
3p12
AA seq 323 aa AA seqDB search
MAEGERQPPPDSSEETPSATPTFIIPKKEIHTVPDMGKWKRSQAYADYIGFILTLNEGVK
GKKLTFDYKVSEAIEKLVALLDTLDRWIDETPPVDQPSRFGNKAYRTWYAKLDQEAENLV
ATVIPTNLAAAVPEVAVYLKEAVGNSTRIDYGTGHEAAFAAFLCCLCKIGVLRVDDQVAI
VFKVFDRYLEVMRKLQKTYRMEPAGSQGVWGLDDFQFLPFIWGSSQLIDHPHLEPRHFVD
EKAVSENHKDYMFLQCILFITEMKTGPFAEHSNQLWNISAVPSWSKVNQGLIRMYKAECL
EKFPVIQHFKFGSLLPIHPVTSG
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggccgagggcgagcggcagccgccgccagattcttcagaagagaccccttcagctact
ccgaccttcatcattccaaaaaaggagatccacacagtcccagatatgggcaaatggaag
cgctctcaggcatatgctgactacatcggctttatcctaaccctgaatgaaggtgtgaaa
gggaagaagctaaccttcgactacaaagtctctgaggccattgagaagctggtggcactt
cttgatacgctggataggtggattgatgaaaccccgccagtggaccagccttcccgattt
gggaacaaagcctacaggacctggtatgccaaactcgatcaggaagcagaaaacttggtg
gctacagtgatccccaccaacctggctgctgctgtgcctgaagtggcagtttacctgaag
gaggctgtggggaactccacacgcattgactatggcacagggcatgaggctgcctttgct
gctttcctctgttgtctctgcaagattggtgtactccgggtggacgaccaggtggctatt
gtcttcaaggtgtttgataggtatcttgaggttatgcggaagttgcagaagacatacagg
atggagcctgcgggcagccagggcgtgtggggtctggatgacttccagttcctgcccttc
atctggggcagctcccagctcatagaccacccccacctggagcccagacattttgtggac
gagaaggcggtgagcgaaaaccacaaggactacatgttcctccagtgcatcctgttcatc
accgagatgaagaccggcccctttgcagagcactccaaccagctgtggaacatcagtgct
gtcccgtcctggtctaaagtgaaccagggcctcattcgcatgtataaggcggagtgcctg
gagaagttccctgtgatccagcacttcaagttcgggagcctgctgcccatccatccggtc
acatcaggctag

DBGET integrated database retrieval system