KEGG   Rattus norvegicus (rat): 362115Help
Entry
362115            CDS       T01003                                 

Gene name
Fam129b, RGD1307018
Definition
(RefSeq) family with sequence similarity 129, member B
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: PH
Motif
Other DBs
NCBI-GeneID: 362115
NCBI-ProteinID: NP_001103355
RGD: 1307018
Ensembl: ENSRNOG00000015845
UniProt: B4F7E8
Position
3p11
AA seq 747 aa AA seqDB search
MGDVLSTHLDDARRQNIAEKTEKILREFLRFYEDQYGVSLFNSMRHEIEGTGPPQAQLLW
RKVPLDERIIFSGNLFQYQEDNKKWRNRFSLVPHNYGLVLYENKVAYERQIPPRAVINSA
GYKVLTSLDQYLELVGNSLPGTTSKSGSTPILKCPTQFPLILWHPYARHYYFCMMTEAEQ
DKWQAVLQDCVRHCNNGIPENSKVEGPAFTDAIRMYRQSKEQYGTWEMLCGNEVQILSNL
VMEELGPALKTELGPRLKGKPQERQRQWIQISDAVYRLVFEQAKVHFEEVLCKLQLARPA
MEAVIRTDMDQIITSKEHLASKIRAFILPKAEVCVRNHVQPYIPSILEALMVPTSQGFTE
VRDVFFKEVTDMNLNVINEGGIDKLGEYMEKLSQLAYHPLKMQSCYEKMEPLRLDGLQQR
FDVSSTSVFKQRAQIHMREQMDNAVYTFETLLHQELGKGPTKEELCKSIQRILERVLKKY
DYDSSSVRKRFFREALLQITIPFLLKKLAPTCKSELPRFQELIFEDFARFILVENTYEEV
VLQTVMKDILQAVKEAAVQRKHNLYRDSVVLHNSDPNLHLLAEGAPIDWGEQYGDGGDGS
DSGGSPCPSEAATLTEKRRRAKQVVSVVQDEESGLPFEAGSEPPSPASPDNVTELRGLLA
QDLQAESSPPASPLLNGAPVQESPQPMTVLEASPPASPLRHLPPGKAVDLEPPKPSDQET
GEKVSSPGSRPPIHTTTEDSAGVQTEF
NT seq 2244 nt NT seq  +upstreamnt  +downstreamnt
atgggagacgtactgtccacacacctggatgacgcgcggcgccagaacatcgcagagaaa
actgagaagatcctgagagagttccttcgtttctatgaggaccagtatggtgtctccctc
ttcaacagcatgcgccatgagattgagggcaccgggcctccgcaggcacagctgctctgg
cgcaaggtgcccctggatgaacgcatcatcttctccgggaaccttttccagtaccaggaa
gacaataagaagtggagaaaccgcttcagcctggtgccccataactatgggctggtgctg
tatgagaacaaagtggcctatgagcggcagataccaccccgggccgtcatcaacagtgct
ggctacaaggttctcacctctctcgaccagtacctggagcttgtggggaattccctacca
gggaccacgtcgaaatcaggctccacccccatccttaagtgcccaacgcagttccctctc
atcctgtggcatccgtatgcccggcactattacttctgcatgatgactgaagcggaacag
gacaagtggcaggcggtgcttcaggattgcgtccgacactgcaacaacgggatcccggag
aactccaaggtggagggcccagcattcacagatgccatccgtatgtaccgccagtcgaag
gagcagtacggcacctgggaaatgctatgtgggaacgaggtgcagatcctaagcaacctg
gtgatggaggagctgggcccagcgctgaagacagagcttgggccacggctgaagggaaag
cctcaggagcggcagcgacagtggatccagatctcggatgctgtgtaccgcctggtattt
gaacaggccaaggtgcactttgaggaggtgctgtgtaagctgcagttggcccggccagcc
atggaggcagttatccgtacagacatggaccagatcatcacctccaaggagcatctggcc
agcaagatccgagccttcatcctccccaaggcagaggtgtgcgtgaggaaccatgtccag
ccctacatcccatccatcctagaggctctgatggtgcccaccagccagggcttcaccgag
gtgcgggacgtcttcttcaaagaggtcacagacatgaatctgaatgtcatcaacgagggt
ggcatcgacaagctgggcgagtacatggagaagctgtcccaactggcgtaccaccccctg
aagatgcagagctgctacgagaagatggagccgctgcggctcgatgggctgcagcagcgc
tttgacgtgtctagcacttctgtgttcaagcagcgagcccagatccacatgcgagagcaa
atggacaatgctgtgtacaccttcgaaaccctcctgcaccaagagctggggaagggaccc
accaaggaggagctgtgcaagtccatccagcggattctggagcgggtgctgaagaaatac
gactatgacagcagttctgtgcgcaagagattcttccgagaggcgctgctgcagatcacc
attcccttcctgctcaaaaagctggcccccacctgcaagtcggagctgccacgcttccag
gagctgatctttgaagactttgccaggttcatcctggtggagaacacatacgaggaggtg
gtgctgcagacggtcatgaaggacatcctgcaggctgtgaaggaggcggcagtgcagcgc
aaacataacctctaccgggacagcgtggttctgcataacagcgaccccaatctacacctg
ctggctgagggtgcacccattgactggggcgaacagtatggtgacggcggtgacggcagt
gacagtggtggcagcccctgcccctccgaagcagccaccctcacagaaaagcgcaggcgt
gccaagcaggtggtgtccgtggtccaggacgaggagtcagggctgccctttgaggctggc
tctgaaccgccatcacctgcatccccggacaatgtcactgagctccgaggcctgttggcc
caggatctgcaggctgaaagttctccaccagccagccccctcctcaatggggccccggtc
caagagagcccccagcccatgacagtcctagaggcttcgccaccagcctcacccctccgg
cacctcccacctggaaaagctgtggaccttgagccccctaaacccagtgatcaagagacc
ggggagaaagtgtctagccctggtagccgtccccccatccataccaccaccgaggacagc
gcaggagtgcagacggagttctag

DBGET integrated database retrieval system