KEGG   Rattus norvegicus (rat): 362119
Entry
362119            CDS       T01003                                 

Gene name
C5
Definition
(RefSeq) complement C5 precursor
  KO
K03994  complement component 5
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04080  Neuroactive ligand-receptor interaction
rno04610  Complement and coagulation cascades
rno04613  Neutrophil extracellular trap formation
rno05020  Prion disease
rno05133  Pertussis
rno05150  Staphylococcus aureus infection
rno05168  Herpes simplex virus 1 infection
rno05171  Coronavirus disease - COVID-19
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    362119 (C5)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    362119 (C5)
   04613 Neutrophil extracellular trap formation
    362119 (C5)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    362119 (C5)
   05168 Herpes simplex virus 1 infection
    362119 (C5)
  09171 Infectious disease: bacterial
   05133 Pertussis
    362119 (C5)
   05150 Staphylococcus aureus infection
    362119 (C5)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    362119 (C5)
  09164 Neurodegenerative disease
   05020 Prion disease
    362119 (C5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    362119 (C5)
Peptidases and inhibitors [BR:rno01002]
 Peptidase inhibitors
  Family I39: alpha2M family
   362119 (C5)
SSDB
Motif
Pfam: TED_complement MG4 MG1 A2M_BRD NTR A2M A2M_recep MG2 MG3 ANATO
Other DBs
NCBI-GeneID: 362119
NCBI-ProteinID: NP_444179
RGD: 2237
Ensembl: ENSRNOG00000018899
Vega: OTTRNOG00000002314
Position
3
AA seq 1688 aa
MPLPAMGLWGLLCLLIFLDKTWGQEQTYVISAPKIFRVGSSENVVIQAHGYTEAFDATIS
LKSYPDKKVTYSSGYVNLSPENKFQNSALLTLPPKQFPRDENPVSHVYLEVVSMHFSKSK
KIPITYDNGFLFIHTDKPVYTPDQSVKIRVYSLSDDLKPAKRETVLTFVDPEGTEVDIVE
ENDYTGIISFPDFKIPSNPKYGVWTIKAKYKKDFTTTGTAYFEVKEYVLPRFSVSIEPES
NFIGYKNFKNFEITVKARYFYNKMVPDAEVYIFFGLREDIKEDEKQMMHKAMQAATLVNG
VAQISFDSETAVKELSYESLEDLNNKYLYIAVTVTESSGGFSEEAEIPGIKYVLSPYTLN
LVATPLFLKPGIPFSIKVQVKDSLEQLVGGVPVTLMAQTVNVNQETSDLEPKRSITHSAD
GVASFVVNLPSEVTSLKFEVKTDAPELPEENQASKEYEAVTYSSLSQSYIYIGWTENYKP
MLVGEYLNIIVTPKSPYIDKITHYNYLILSKGKIVQYGTKEKLLYSSYQNINIPVTQDMV
PSARLLVYYIVTGEQTAELVADAVWINIEEKCGNQLQVHLSPDKDVYSPGQTVSLDMVTE
ADSWVALSAVDSAVYGVRGKAKRAMQRVFQAFDDKSDLGCGAGGGRDNVDVFHLAGLTFL
TNANADDSQYHDDSCKEILRPKRDLQLLHQKVEEQAAKYKHRVPKKCCYDGARENKYETC
EQRVARVTIGPHCIRAFNECCTIADKIRKESHHKGMLLGRIQIKALLPVMKAEIRSYFPE
SWLWEVHRVPKRNQLQVALPDSLTTWEIQGIGISDNGICVADTLKAKVFKDVFLEMNIPY
SVVRGEQIQLKGTVYNYRTSGTMFCVKMSAVEGICTPGSSAASPQTSRSSRCVRQRIEGS
SSHLVTFSLLPLEIGLHSINFSLETSFGKEILVKTLRVVPEGIKRESYAGVTLDPRGVYG
IVNRRKEFPYRIPLDLVPKTNVKRILSVKGLLIGEFLSTVLSKEGIDILTHLPKGSAEAE
LMSIVPVFYVFHYLEAGNHWNIFHPDTLARKQSLQKKIKEGLVSVMSYRNADYSYSMWKG
ASSSAWLTAFALRVLGQVNKYVKQDQYSICNSLLWLIEKCQLENGSFKENSQYLPIKLQG
TLPAEAQENTLYLTAFSVIGIRKAIGICPTEKIYTALAKADSFLLERTLPSKSTFTLAIV
AYALSLGDRTHPKFRSIVSALKREALVKGDPPIYRFWRDTLQRPDSSAPNSGTAGMVETT
AYALLTSLNLKETSYVNPIIKWLSEEQRYGGGFYSTQDTINAIEGLTEYSLLVKQLHLDM
DINVSYKHKGDFYQYKVTEKNFLGRPVEVPLNDDLIVTTGYSSGLATVYVKTVVHKTSVA
EEFCSFYLKIDTQEVEASSYLSYSDSGHKRIIACASYKPSKEESASGSSHAVMDILLPTG
IGANQEDLRALVEGVDQLLTDYQIKDSHVILQLNSIPSRDFLCVRFRIFELFQVGFLNPA
TFTVYEYHRPDKQCTMIYSTSDTNLQRVCEGAACKCVEADCGQLQAELDLAISADTRKET
ACKPEIAYAYKVRITSATEENIFVKYTATLLDIYKTGEAAAEKDSEITFIKKISCTNANL
VKGKQYLIMGKEALQIKHNFSFKYIYPLDSSTWIEYWPTDTTCPSCQAFVANLDEFAEDI
FLNGCENA
NT seq 5067 nt   +upstreamnt  +downstreamnt
atgccgcttccagccatgggcctttggggactactttgccttttaattttcctggacaag
acctggggacaggaacaaacctacgtcatttcagcacccaaaatcttccgggtcggatca
tccgaaaatgtcgtaattcaagcccatggctacaccgaagcctttgacgcaacgatctct
ctgaaaagctatcctgacaaaaaagtgacctactcttccggctatgttaacttgtcgccg
gaaaacaaattccagaactcagcactgttgacattaccgcccaaacaatttcccagagat
gaaaacccagtctctcacgtgtatctggaagttgtgtcaatgcacttttcgaaatcgaag
aaaataccaataacctatgacaatggatttctcttcatccatacagacaaacctgtttac
actccagaccagtcagtaaagattagagtctactctctgagtgacgacttgaagccagcc
aaacgggagactgtcttaactttcgtagatcccgaaggaacagaagttgacatcgtagaa
gaaaatgattatactggaattatctcttttcctgacttcaagattccatctaatcccaag
tatggtgtatggacaattaaagctaaatataagaaggattttacaacgactggaactgca
tactttgaagttaaagaatatgtcttgccccgattctctgtatcaatagaaccagaaagc
aacttcattggctataagaactttaagaactttgaaatcactgtgaaagcaagatatttt
tataataaaatggtccccgatgctgaagtctatatcttttttgggttgagagaggacata
aaagaggatgagaaacagatgatgcataaagccatgcaagccgcaacgttggtcaatgga
gttgctcagatctcttttgactctgaaacagcagtgaaagagctgtcatatgaaagtcta
gaagatctaaacaataagtacctttatattgctgtaacagtcacagagtcttcaggtggg
ttttcggaagaggcagaaattcctggcatcaaatacgtcctctctccctatacactgaat
ttggtcgctacccctcttttcctgaagcctgggattccattttccatcaaggtacaggtt
aaggattcactcgagcagttggtaggaggggtcccagtaactctgatggcacaaacagtc
aatgtgaatcaagagacatctgacttggaaccaaagaggagcatcacacactctgctgat
ggagtggcttcatttgtggtgaacctcccatcagaagtgacatcactgaagtttgaggtc
aaaactgatgccccggaacttcccgaagaaaatcaagccagcaaagaatatgaagcagtt
acatactcatccctcagccagagttacatttacattggctggactgaaaactacaagccc
atgcttgtgggagaatatctgaatattatcgtcacccccaagagtccatatattgacaaa
ataactcactataattacttgattttatccaaaggcaaaattgtacagtatggcacaaag
gagaaacttctctattcatcttatcaaaatataaacatcccagtgacacaggacatggtt
ccttcagcgcggctcctggtctattacatagtcacgggggagcagacagcagaattggtg
gctgacgcagtctggataaacattgaggagaagtgtggcaaccagctccaggtccatctg
tctccagataaagacgtgtattctccaggccaaactgtgtcccttgacatggtgactgaa
gcagactcatgggtggcactatctgcggtggacagcgctgtgtatggagtccggggaaaa
gccaaaagggccatgcaaagagtgttccaagcttttgatgacaagagtgacctgggctgt
ggggcaggtggtggccgtgacaatgtagatgtattccatctagctgggctcaccttcctc
accaatgcaaacgcagatgactcccaataccacgatgactcttgtaaggaaattctcagg
ccaaagagagacctgcagctcctgcatcagaaagtggaagaacaagctgctaaatacaaa
caccgtgtgcccaagaaatgctgttatgatggagcccgagaaaacaaatacgaaacctgt
gagcagcgagttgcccgggtgaccataggcccacactgcatcagggccttcaacgagtgt
tgtactattgcggataagatccgaaaagaaagccaccacaaaggcatgctgttgggaagg
atccaaataaaggccctgttaccagtgatgaaggcagaaatccgaagctactttccagag
agctggctatgggaagttcatcgtgttcccaaaagaaaccagctgcaggttgcactgcct
gactcactgacgacctgggaaattcaaggcatcggcatctcagacaatggtatatgtgtt
gctgacacactcaaggcaaaggtgttcaaagatgtcttcctggagatgaacataccatat
tctgttgtacgaggggagcagatccaattgaagggaaccgtttacaattataggacctct
gggacaatgttctgtgttaaaatgtctgccgtggagggaatctgcactccaggaagctcg
gctgctagccctcagacctctaggtcctccagatgtgtgcgccagagaatagagggctcc
tccagtcacttggtgaccttcagcctgcttcctctggaaattggccttcactccataaac
ttctcactagagacttcatttgggaaagaaatcttagtgaagacattacgggtagtgcca
gaagggatcaaaagggaaagctatgctggtgtgactctggaccccaggggagtttatggt
attgttaacagacgaaaggaattcccatacaggataccattagatttggtccccaaaacc
aacgtcaaaaggattttgagtgtaaaaggactgcttataggggaattcttgtccacggtt
ctgagtaaagaaggcatcgacatcctaacccacctccccaagggcagcgccgaggcagaa
ctcatgagcatagtcccggtgttctacgttttccactacctggaagcaggaaaccattgg
aatattttccaccctgatacgttagctagaaaacagagcctgcagaaaaaaataaaagaa
gggctggtgagcgtcatgtcctacagaaacgctgactattcctacagcatgtggaaggga
gcaagctctagtgcctggctgacagcttttgctctgagagtgcttggacaggtgaacaag
tatgtgaaacaagaccaatactcgatctgtaactccttgttatggctgattgagaagtgt
cagctggaaaacggatctttcaaggaaaattcccaatatctaccaataaaattacagggt
actttgcctgctgaagcccaagagaacactttatatcttacagccttttctgtgattgga
attagaaaggctattggcatatgccccacggagaaaatctacacagcgctggctaaagct
gactccttcctacttgaaaggaccctgccttccaagagcaccttcaccctggccattgtg
gcctatgctctctccctgggagacagaacccacccgaagtttcgttctattgtgtcagcc
ctgaagagggaagctttggttaaaggagacccgcccatttaccgtttctggagagacact
ctccaacgtccagacagctcagcacccaacagcggcacagcaggtatggtagaaaccacg
gcctatgctttgctcaccagcctgaacctgaaggagacgagttatgtcaacccgatcatc
aagtggctatctgaggagcagaggtatggaggcggcttttattccacccaggataccatt
aacgccatcgagggcctgacagagtattcactcctggttaaacaacttcatttggatatg
gatatcaatgtctcctacaaacacaaaggggatttctaccagtataaagtgacagagaag
aacttcctcgggaggccagtggaggtacccctcaatgatgacctcatcgtcaccacaggc
tatagcagtggcttggctacagtatatgtaaaaactgtggttcacaaaactagtgtcgct
gaggaattttgcagcttttacttgaaaattgatacccaagaagttgaagcctccagctac
ctcagctacagtgactcgggacacaagcgcataatagcctgtgccagctacaagcccagc
aaggaggagtcagcatctgggtcctcccatgcagtaatggatatactgctgccgaccgga
atcggagcaaaccaagaagatttacgagctcttgtggaaggagtagatcaactcctaact
gattaccagatcaaagacagtcatgttattctgcaattgaattcgattccctccagagat
ttcctttgtgttcggttccggatatttgaacttttccaagttgggtttctgaatcctgct
acgttcacggtgtacgagtatcacagaccagataagcagtgtaccatgatttacagcact
tctgacaccaaccttcagagagtctgtgaaggagcggcatgcaaatgcgttgaagctgat
tgtgggcaactgcaggcagaactggacctggccatctctgcagacaccaggaaagaaaca
gcatgtaaaccagagattgcatatgcttataaggtcaggatcacgtcggccacggaagaa
aacatttttgtcaagtacactgcgacgcttctggatatttacaaaacaggggaagccgct
gctgagaaggactctgagatcaccttcattaaaaagataagctgtaccaacgccaacctg
gtgaaaggaaagcaatatttaatcatgggcaaagaggctctgcagatcaaacacaatttc
agtttcaagtatatataccctctagattcctccacctggattgaatattggcccacagac
acaacgtgtccatcctgccaagcgtttgtagctaatttggacgagttcgctgaagacatc
tttctaaatggctgtgaaaatgcctga

DBGET integrated database retrieval system