KEGG   Rattus norvegicus (rat): 362154Help
Entry
362154            CDS       T01003                                 

Gene name
Zc3h15
Definition
(RefSeq) zinc finger CCCH-type containing 15
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: DFRP_C zf-CCCH_4 zf-CCCH zf_CCCH_4 Torus zf-CCCH_3 zf-CCCH_2
Motif
Other DBs
NCBI-GeneID: 362154
NCBI-ProteinID: NP_001010963
RGD: 1359234
Ensembl: ENSRNOG00000005256
UniProt: Q6U6G5
Position
3q24
AA seq 426 aa AA seqDB search
MPPKKQAQAGGSKKAEQKKKEKIIEDKTFGLKNKKGAKQQKFIKAVTHQVKFGQQNPRQV
AQSEAEKKLKKDDKKKELQELNELFKPVVAAQKISKGADPKSVVCAFFKQGQCTKGDKCK
FSHDLTLERKCEKRSVYIDARDEELEKDTMDNWDEKKLEEVVNKKHGEAEKKKPKTQIVC
RHFLEAIENNKYGWFWVCPGGGDNCMYRHALPPGFVLKKDKKKEEKEDEISLEDLIERER
SALGPNVTKITLESFLAWKKRKRQEKIDKLEQDMERRKADFKAGKALVISGREVFEFRPE
LVNDDDEEADDTRYIQGTGGDEVDDSVGVNDIDLSLYVPRDVEETGITVASLERFSTYAS
DKDENKLSEASGGLAENGERSDLDEDSGGGGQENGSIDAVPVDENLFTGEDLDELEEELN
TLDLEE
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgccccccaagaaacaggctcaggccgggggcagcaagaaggcggagcagaagaagaag
gagaagatcatcgaggacaaaacttttggactaaagaataagaagggagcaaaacaacag
aaatttattaaggctgtcactcatcaagtgaaatttggacaacagaatcctcgtcaggta
gcacaaagtgaagctgaaaagaaattgaagaaagatgacaagaagaaagagctacaagaa
ctaaatgagttgttcaaaccggtagttgctgcacaaaaaataagtaaaggtgcggacccc
aaatctgtggtgtgcgcattcttcaaacagggacagtgtactaaaggagataaatgtaag
ttctctcatgacctcactttggagagaaaatgtgaaaaacgaagtgtttacattgatgca
agagatgaagaacttgaaaaagataccatggataactgggatgagaaaaagctggaagaa
gtagtaaacaagaagcacggtgaggcggaaaagaaaaaaccaaaaactcaaatagtgtgc
agacattttcttgaagctattgaaaataacaagtatggctggttttgggtgtgtcctgga
ggtggggacaattgcatgtatcgccatgcacttcctcctgggtttgtgctaaagaaagac
aaaaagaaagaagaaaaagaagatgaaatatcattagaagatctaattgaaagagagcgt
tctgccctaggtccaaatgttaccaaaatcactctagaatcttttcttgcatggaagaaa
aggaaaagacaagaaaagattgataaacttgaacaagatatggagaggcggaaagctgac
ttcaaagcagggaaagcgctggtgatcagtggtcgtgaggtgtttgagtttcgtccagag
ctggtcaacgatgacgacgaggaagcagacgacacccgttacattcagggaacaggaggt
gatgaggttgatgactctgtgggtgtaaatgacatagatctaagcctctatgtcccaaga
gatgtggaagagacagggatcactgtggccagtcttgaaagattcagcacctatgcgtca
gataaggacgagaacaaattaagtgaagcttctggaggtctggctgaaaatggtgaaaga
agtgatttggatgaggacagcggagggggaggacaggaaaatgggtccatcgatgctgtt
cctgttgatgaaaacctgttcactggtgaagatctggatgaactagaagaagaattaaac
acacttgatttagaagaatga

DBGET integrated database retrieval system