KEGG   Rattus norvegicus (rat): 362160Help
Entry
362160            CDS       T01003                                 

Gene name
Celf1, Cugbp1
Definition
(RefSeq) CUGBP, Elav-like family member 1
  KO
K13207  CUG-BP- and ETR3-like factor
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:rno03041]
    362160 (Celf1)
Spliceosome [BR:rno03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    362160 (Celf1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RRM_1 RNA_bind RRM_7 Nup35_RRM_2
Motif
Other DBs
NCBI-GeneID: 362160
NCBI-ProteinID: NP_001020592
RGD: 1307721
Ensembl: ENSRNOG00000010379
UniProt: Q4QQT3
Position
3q24
AA seq 487 aa AA seqDB search
MNGTLDHPDQPDLDAIKMFVGQVPRTWSEKDLRELFEQYGAVYEINILRDRSQNPPQSKG
CCFVTFYTRKAALEAQNALHNMKVLPGMHHPIQMKPADSEKNNAVEDRKLFIGMISKKCT
ENDIRVMFSSFGQIEECRILRGPDGLSRGCAFVTFTTRTMAQTAIKAMHQAQTMEGCSSP
MVVKFADTQKDKEQKRMAQQLQQQMQQISAASVWGNLAGLNTLGPQYLALYLQLLQQTAN
SGNLNTLSSLHPMGGLNAMQLQNLAALAAAASAAQNTPSGTNALTTSSSPLSVLTSSAGS
SPSSSSSNSVNPIASLGALQTLAGATAGLNVGSLAGMAALNGGLGSSGLSNGTGSTMEAL
TQAYSGIQQYAAAALPTLYNQNLLTQQSIGAAGSQKEGPEGANLFIYHLPQEFGDQDLLQ
MFMPFGNVVSAKVFIDKQTNLSKCFGFVSYDNPVSAQAAIQSMNGFQIGMKRLKVQLKRS
KNDSKPY
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgaacggcaccctggaccacccagaccaaccagatcttgatgctatcaagatgtttgtg
ggccaggttccaaggacctggtcggagaaagacttgagggagctttttgagcagtatggt
gctgtctatgaaatcaacatcctaagggataggagccaaaaccctcctcagagcaaaggg
tgctgttttgttacattttacacccgtaaagctgcattagaagctcagaatgctctccac
aacatgaaggttctacctgggatgcatcaccctatacagatgaaacccgcggacagtgag
aagaacaacgctgtggaagacaggaagctgtttattggtatgatttccaagaagtgtact
gaaaatgacatccgagtcatgttttcttcgtttggacagattgaagagtgccggatattg
cggggacctgatggcttgagcagaggttgtgcatttgtgacttttacaacaagaaccatg
gcacagacagctatcaaagcaatgcaccaagcacagaccatggagggttgctcatccccc
atggtggtaaagtttgctgacacccagaaggacaaagaacagaagagaatggcccagcag
ctccagcagcagatgcagcagattagtgcagcgtctgtgtgggggaacctggctggtctg
aacacacttgggccccagtacttagcactttatttgcagctccttcagcagactgccaac
tctgggaacctcaacaccctgagcagcctccacccaatgggagggttaaatgcaatgcag
ctccagaatttggctgcactggctgctgcagctagtgcagctcagaatacaccaagtggt
accaatgctctcactacatccagcagtcccctcagcgtactcaccagttcagcagggtct
tcaccgagctccagcagcagtaattctgtcaaccccatagcctcacttggagcgctgcaa
acattagccggagcaacagctggcctcaacgttggctcattggcaggaatggctgctttg
aatggaggtttgggcagcagtggcctttccaatggcactgggagtaccatggaagccctc
acccaggcgtattctggtatccagcaatatgctgctgcagccctccctactctgtacaac
cagaatctgttgacacagcagagtattggtgctgctggaagccagaaggaaggtccagaa
ggagccaacctgttcatctatcacctgccccaagagtttggagaccaggacttactgcag
atgtttatgccctttgggaatgtcgtgtctgccaaggttttcatagacaagcagaccaac
ctgagcaagtgttttggttttgtaagttatgacaatcctgtctcagctcaagctgccatc
cagtccatgaacggctttcaaattggaatgaagaggcttaaagtgcagctcaaacgttcg
aagaatgatagtaagccctactga

DBGET integrated database retrieval system