KEGG   Rattus norvegicus (rat): 362164
Entry
362164            CDS       T01003                                 

Gene name
Atg13
Definition
(RefSeq) autophagy-related protein 13
  KO
K08331  autophagy-related protein 13
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04136  Autophagy - other
rno04140  Autophagy - animal
rno04211  Longevity regulating pathway
rno05010  Alzheimer disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05017  Spinocerebellar ataxia
rno05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    362164 (Atg13)
   04136 Autophagy - other
    362164 (Atg13)
 09150 Organismal Systems
  09149 Aging
   04211 Longevity regulating pathway
    362164 (Atg13)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    362164 (Atg13)
   05014 Amyotrophic lateral sclerosis
    362164 (Atg13)
   05016 Huntington disease
    362164 (Atg13)
   05017 Spinocerebellar ataxia
    362164 (Atg13)
   05022 Pathways of neurodegeneration - multiple diseases
    362164 (Atg13)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    362164 (Atg13)
   03029 Mitochondrial biogenesis [BR:rno03029]
    362164 (Atg13)
Membrane trafficking [BR:rno04131]
 Autophagy
  Autophagosome formation proteins
   ULK complex
    362164 (Atg13)
   Atg1 complex
    362164 (Atg13)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    362164 (Atg13)
SSDB
Motif
Pfam: ATG13
Other DBs
NCBI-GeneID: 362164
NCBI-ProteinID: NP_001258141
RGD: 1310685
Ensembl: ENSRNOG00000016984
Position
3
AA seq 479 aa
METDLSSQDRKDLDKFIKFFALKTVQVIVQARLGEKICTRSSSSPTGSDWFNLAIKDIPE
VTHEAKKALSGQLPAVGRSMCVEISLKTSEGDSMELEIWCLEMNEKCDKEIKVSYTVYNR
LSLLLKSLLAITRVTPAYRLSRKQGHEYVILYRIYFGEVQLNGLGEGFQTVRVGTVGTPV
GTLTLSCAYRINLAFMSTRQFERTPPIMGIIIDHFVDRPYPSSSPMHPCNYRTAEDAGVA
YPSVEDSQEVCTTSFSTSPPSQLMVPGKEGGVPLAPNHPAHGAQADQERLVVHMPSDGTH
CAATPSSSEDTETVSNSSEGRASPHDILETIFVRKVGAFVNKPINQVTLTSLDIPFAMFA
PKNLELEDADPMVNPPDSPETTSPLHGSLHSEGSSGGSSGNAHDDFVMIDFKPAFSKDDI
LPMDLGTFYREFQNPPQLSSLSIDFGAQSMAEDLDSLPEKLAVHEKNVREFDAFVETLQ
NT seq 1440 nt   +upstreamnt  +downstreamnt
atggaaactgatctcagttcccaggacagaaaggacctggacaagtttattaagtttttt
gccctcaagactgtccaagtgattgtccaggctcgacttggagaaaagatttgcacccgt
tcatcatcttccccgacgggttcagattggttcaatttagcaatcaaagatatcccagaa
gtcacccatgaagcaaagaaggccctgtctgggcagctgcctgctgtggggcgatctatg
tgtgtggagatctcactcaagacttctgagggagattccatggagttggaaatttggtgt
cttgaaatgaatgaaaagtgtgacaaagaaatcaaagtttcctacactgtatacaaccga
ttgtcactgctgctgaagtctctccttgctattacgagggtgacaccagcctatagactc
tccaggaagcaagggcatgaatatgtaattttgtacaggatttattttggagaagttcaa
ctgaatggcttaggagaaggcttccagacagttcgtgttggaacagtgggcacccccgtg
ggtaccctcactctttcctgtgcttatagaattaacttggcgttcatgtccaccaggcaa
tttgagaggaccccacctatcatggggattatcattgatcactttgttgaccgtccctat
cccagctcctctcctatgcacccttgcaattacagaactgctgaggatgctggagtcgca
tacccatcagtggaagactctcaggaagtgtgtaccacatctttttccacatcccctccc
tcccagctgatggttcctgggaaggaaggtggggtgcctcttgctcccaaccaccctgct
catggtgcccaggctgatcaggagagactggtggtgcacatgccttctgatggaacccac
tgtgcagccacaccctccagcagtgaggacactgagactgtatctaacagcagtgaagga
cgggcctcaccccatgacatcctggaaactatctttgtccgaaaagtgggagcatttgtc
aacaaacccatcaatcaggtgacactgacgagtttggacataccctttgccatgtttgct
cccaagaatttggagctggaggatgctgatcctatggtgaaccctccagactccccagag
accacgtctcccctccatggcagtctgcactcagagggctccagcgggggcagcagtggc
aatgcacatgatgactttgtcatgattgactttaaaccagctttttctaaagacgacatt
cttccaatggacttggggaccttttaccgtgaatttcagaatccccctcagctgagcagc
ctctccatagattttggagctcagtctatggcagaagacttggactccttaccagagaag
ctggctgtgcatgagaagaatgtccgagaatttgatgccttcgtcgaaaccctgcagtaa

DBGET integrated database retrieval system