KEGG   Rattus norvegicus (rat): 362169
Entry
362169            CDS       T01003                                 

Gene name
Alkbh3
Definition
(RefSeq) alpha-ketoglutarate-dependent dioxygenase alkB homolog 3
  KO
K10860  mRNA N1-methyladenine demethylase [EC:1.14.11.54]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:rno03400]
    362169 (Alkbh3)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.54  mRNA N1-methyladenine demethylase
     362169 (Alkbh3)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   Direct repair
    362169 (Alkbh3)
SSDB
Motif
Pfam: 2OG-FeII_Oxy_2
Other DBs
NCBI-GeneID: 362169
NCBI-ProteinID: NP_001014202
RGD: 1359731
Ensembl: ENSRNOG00000021678
UniProt: Q5XIC8
Position
3
AA seq 295 aa
MGDKRQRARVQGAWATPTKSQSAARPATPARSRPSQTPGPSWRSKEQQQCDRRFVFKEPQ
LVVRAAPEPRVIDREGVYEISLSPTGVSRVCLYPGFVDLKEADWILERLCQDVPWKQRMG
IREDITYPQPRLTAWYGELPYTYSRVTMEPNPHWLPVLWTLKSRIEENTGHTFNSLLCNF
YRDEKDSVDWHSDDEPSLGSCPVIASLSFGATRTFEMRKKPPPEENGDYTYVERVKIPLD
HGTLLIMEGATQADWQHRVPKEYHSRERRVNLTFRTVYPDPRGAPGDTSAELPLR
NT seq 888 nt   +upstreamnt  +downstreamnt
atgggggacaagagacagcgagcccgagtgcagggagcctgggccacacctaccaagagc
cagtctgctgctcggccagctactcctgctagaagccgtccttcccagacaccagggcca
agctggaggagcaaggaacagcagcaatgtgaccgacggtttgtgttcaaagaaccgcag
ctggttgtacgtgcagccccagagcccagagtgattgacagggagggtgtgtacgaaatc
agcctgtcccctacaggtgtgtctagggtgtgtttatatcctggctttgtggacttgaag
gaagctgactggatcttggagcggctttgtcaagatgtcccctggaaacagaggatgggc
atcagagaggatataacttatccgcaaccaagacttacagcatggtatggagagcttcct
tacacttactcaagagtcactatggaaccaaatcctcactggcttcctgtgctgtggact
ctgaagagccgcattgaggagaacactggccacaccttcaactccttgctgtgtaatttt
taccgggacgagaaggacagtgtggactggcacagcgatgatgagccatccctggggagc
tgccctgtcattgcttcactcagttttggtgccactcggacttttgagatgaggaagaaa
cccccacctgaagagaatggagactatacttatgtggagagagtgaagataccattggat
cacgggaccttgctaatcatggaaggagccacgcaagctgactggcagcaccgagtgccc
aaggaataccactccagagaacggagagtaaacctaacctttcggaccgtttatccagac
ccaagaggagcccccggtgatacttctgcagagctgccactgaggtga

DBGET integrated database retrieval system