KEGG   Rattus norvegicus (rat): 362173
Entry
362173            CDS       T01003                                 

Gene name
Caprin1, GPI_p137, Gpiap1, rng105
Definition
(RefSeq) cell cycle associated protein 1
  KO
K18743  caprin-1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    362173 (Caprin1)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Other mRNA localization factors
     362173 (Caprin1)
SSDB
Motif
Pfam: Caprin-1_C Caprin-1_dimer DUF1140
Other DBs
NCBI-GeneID: 362173
NCBI-ProteinID: NP_001012185
RGD: 1305707
Ensembl: ENSRNOG00000009152
UniProt: Q5M9G3
Position
3q32
AA seq 707 aa
MPSATSHSGSGSKSSGPPPPSGSSGSEAAAGAAAPASQHPATGTGAVQTEAMKQILGVID
KKLRNLEKKKGKLDDYQERMNKGERLNQDQLDAVSKYQEVTNNLEFAKELQRSFMALSQD
IQKTIKKTARREQLMREEAEQKRLKTVLELQYVLDKLGDDDVRTDLKQGLSGVPILSEEE
LSLLDEFYKLVDPERDMSLRLNEQYEHASIHLWDLLEGKEKPVCGTTYKALKEIVERVFQ
SNYFDSTHNHQNGLCEEEEAASAPIVEDQVAEAEPEPTEEYTEQSEVESTEYVNRQFMAE
TQFSSGEKEQVDEWAVETVEVVNSLQQQPQAASPSVPEPHSLTPVAQSDPLVRRQRVQDL
MAQMQGPYNFIQDSMLDFENQTLDPAIVSAQPMNPTQNMDMPQLVCPQVHSESRLAQSNQ
VPVQPEATQVPLVSSTSEGYTASQPLYQPSHAAEQRPQKEPIDQIQATISLNTEQTTASS
SLPAASQPQVFQAGASKPLHSSGINVNAAPFQSMQTVFNMNAPVPPVNEPETLKQQSQYQ
ASYNQSFSSQPHQVEQTELQQDQLQTVVGTYHGSQDQPHQVPGNHQQPPQQSTGFPRSSQ
PYYNSRGVSRGGSRGARGLMNGYRGPANGFRGGYDGYRSSFSNTPNSGYTQSQFNAPRDY
SGYQRDGYQQNFKRGSGQSGPRGAPRGRGGPPRPNRGMPQMNTQQVN
NT seq 2124 nt   +upstreamnt  +downstreamnt
atgccctcggccaccagccacagcggaagcggcagcaaatcgtcgggaccgccgccgccg
tccggttcctccgggagtgaggcggcggccggggcagctgcgccggcttctcagcatccg
gcaaccggcaccggcgcggtccagaccgaggccatgaagcagattctcggcgtgatcgac
aagaaacttcggaaccttgagaagaaaaagggtaaacttgatgattaccaggaacgaatg
aataaaggggaaaggctcaatcaagaccagctggatgccgtatctaagtaccaggaagtc
acaaataatttggagtttgcaaaggaattacagagaagtttcatggcattaagtcaggat
attcagaaaacaataaagaagacagcacgtcgggagcagcttatgagagaagaagcagaa
cagaagcgcttaaaaactgtacttgagttacagtatgtattggataagctgggagatgat
gatgtgagaacggatctgaagcaggggctgagtggagtgccaatattgtctgaagaggag
ttgtcattgttggatgaattctacaagctagtagatcccgagcgggacatgagtttaagg
ttaaatgagcagtatgaacatgcctccattcacttgtgggatttgctggaagggaaagaa
aagcctgtatgtggaacaacctataaagctctaaaggaaattgtcgagcgtgtttttcag
tcaaactactttgacagcactcataatcatcaaaatggattgtgtgaggaggaagaggca
gcttcagcacctatagtggaagaccaggtagctgaagctgaacctgaaccaacggaagaa
tacacagagcaaagtgaggttgagtcaacagagtatgtcaataggcagttcatggcggaa
acacagttcagcagtggtgagaaggagcaagtggatgagtgggcagttgaaacagttgag
gtggtaaactcactccagcagcaacctcaggctgcatctccttcagtaccagagccccac
tctctgactccagtggctcagtcagatccacttgtgagaagacagcgagtacaagatctt
atggcacaaatgcaagggccctataatttcatacaggattcaatgttggattttgaaaat
cagacgcttgatcctgccattgtatcagcacaacctatgaaccctacccaaaacatggat
atgcctcagctggtttgccctcaggttcattctgaatctagacttgcccaatctaatcaa
gttcctgtacaaccagaagccacacaggttcctttggtctcatccacaagcgaggggtac
actgcgtctcagcccctgtaccagccgtctcatgctgcagagcagcggccacaaaaggag
cccattgatcagattcaggcaacaatatctttaaatacagagcagactacagcatcatca
tcccttcctgctgcttctcagcctcaagtgttccaggctggggcaagtaaacctttgcat
agcagtggaatcaatgtaaatgcagctccattccaatccatgcaaacggtgtttaatatg
aatgccccagttcctcctgttaatgaaccagaaactttaaaacaacagagtcagtaccag
gccagttataaccagagcttttccagtcagcctcaccaagtggaacaaacagagcttcaa
caagaccagctgcaaactgtggttggcacttaccatggatcccaggaccagcctcatcaa
gtgcctggtaaccaccagcagcccccccagcagagcaccggctttccacgtagcagtcag
ccttattacaacagtcgcggtgtatctcgaggagggtctcgtggtgccagaggtttgatg
aatggatacaggggccctgccaatggatttagaggaggatatgatggttaccgctcttca
ttctccaacactccaaacagtggctatacacagtctcagttcaatgctccccgggactac
tctggctaccagcgggatggatatcagcagaatttcaagcgaggctctgggcagagtgga
ccacggggagccccacgaggtcgtggagggcccccaagacccaacagagggatgccgcaa
atgaacactcagcaagtgaattaa

DBGET integrated database retrieval system