KEGG   Rattus norvegicus (rat): 362218Help
Entry
362218            CDS       T01003                                 

Gene name
Rnf24
Definition
(RefSeq) ring finger protein 24
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 362218
NCBI-ProteinID: NP_001102061
RGD: 1309384
Ensembl: ENSRNOG00000021250
UniProt: D3ZVL8
Position
3q36
AA seq 103 aa AA seqDB search
MNWGFAHVSMPSTESALLSGWKSGKCVPCATCRCCSWPSCTVNRTEVPLRSPSLGQRILY
SLLQGSDCRWTHQYGARRNTSRLYFGCSTWDTHCHFLCLMKNS
NT seq 312 nt NT seq  +upstreamnt  +downstreamnt
atgaactggggatttgcccatgtaagcatgccttccacagaaagtgccttgttaagtggc
tggaagtccggaaagtgtgtcccctgtgcaacatgccggtgctgcagctggcccagttgc
acagtaaacaggaccgaggtccccctcaggagcccctccctggggcagagaatattgtat
agcttgctgcaaggatcagactgtcgctggacacatcagtacggagccaggaggaacaca
agcagactctattttggctgctctacctgggatacccactgtcacttcctttgcctcatg
aagaactcctga

DBGET integrated database retrieval system