KEGG   Rattus norvegicus (rat): 362219Help
Entry
362219            CDS       T01003                                 

Gene name
Gpcpd1, Gde5, Prei4, RGD735140
Definition
(RefSeq) glycerophosphocholine phosphodiesterase 1
  KO
K18695  glycerophosphocholine phosphodiesterase GPCPD1 [EC:3.1.4.2]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00564  Glycerophospholipid metabolism
rno05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    362219 (Gpcpd1)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    362219 (Gpcpd1)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.2  glycerophosphocholine phosphodiesterase
     362219 (Gpcpd1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GDPD CBM_20
Motif
Other DBs
NCBI-GeneID: 362219
NCBI-ProteinID: NP_942074
RGD: 735140
Ensembl: ENSRNOG00000053201
UniProt: Q80VJ4
Position
3q36
AA seq 672 aa AA seqDB search
MTPSQVTFEIRGTLLPGEVFAMCGNCDALGNWSPQNAVPLTESETGESVWKAVIVLSRGM
SVKYRYFRGCFLEPKTIGGPCQVIVHKWETHLQPRSITPLENEIIIDDGQFGIHNGVETL
DSGWLTCQTEIRLRLHFSEKPPVSITKKKFKKSRFRVKLTLEGLEEDDDDDDKASPTVLH
KMSNSLEISLISDNEFKCRHSQPECGYGLQPDRWTEYSIQTMEPDNLELIFDFFEEDLSE
HVVQGDVLPGHVGTACLLSSTIAESERSAGILTLPIMSRSSRKTIGKVRVDFIIIKPLPG
YSCSMQSSFSKYWKPRIPLDVGHRGAGNSTTTAKLAKVQENTIASLRNAASHGAAFVEFD
VHLSKDLVPVVYHDLTCCLTMKRKYEADPVELFEIPVKELTFDQLQLLKLSHVTALKTKD
QKQCMAEEENSFSENQPFPSLKMVLESLPENVGFNIEIKWICQHRDGVWDGNLSTYFDMN
AFLDIILKTVLENSGKRRIVFSSFDADICTMVRQKQNKYPILFLTQGKSDIYPELMDLRS
RTTPIAMSFAQFENILGINAHTEDLLRNPSYVQEAKDKGLVIFCWGDDTNDPENRRKLKE
FGVNGLIYDRIYDWMPEQPNIFQVEQLERLKRELPELKNCLCPTVSHFIPPSFCMESKIH
VDANGIDNVENA
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
atgacaccttctcaggtcacctttgaaataagaggaactcttttaccaggagaggtcttt
gcaatgtgtggaaactgtgatgccttgggaaactggagtcctcaaaatgctgtgcctctt
actgagagtgagacaggcgaaagtgtatggaaagcagtgattgttcttagtagaggaatg
tccgtgaagtaccgctacttcagaggctgctttttagaaccaaagactatcggtggtcca
tgtcaagtcatagttcacaagtgggagactcatctacaaccacgatcaataaccccttta
gaaaacgaaatcattattgacgatggacaatttggaatccacaatggtgttgaaacactg
gattctggatggcttacctgtcagactgaaataagactgcgtctgcatttttctgagaaa
cctcctgtttcaattaccaagaaaaagttcaaaaaatctagatttagggtaaagcttaca
ctagagggtctggaggaagatgatgacgacgatgataaggcatctcccactgttcttcac
aagatgtccaatagcctggagatatccttaataagtgacaatgagttcaagtgcaggcac
tcacagccagaatgtgggtatggcttacagcctgaccgctggacagagtacagcatacag
acaatggagccggacaaccttgaactcatctttgacttttttgaggaagatctcagtgag
catgtagtccagggtgatgttcttcctggacatgtgggcacagcatgcctcctgtcatct
accattgctgagagtgagagaagcgctggaatccttactcttcccatcatgagcagaagt
tccagaaaaactataggcaaagtcagagttgattttatcatcatcaagccattaccagga
tatagttgttctatgcagtcttcattctccaagtattggaaaccaagaataccactggat
gttggacatcgtggtgcagggaactcaacaacaactgccaagctggctaaagtacaggaa
aatactattgcttctttaagaaatgctgccagccatggtgcagcatttgtggaatttgat
gtccacctttcaaaggacttagtgcctgtagtgtatcatgatctcacctgctgtttaact
atgaaaaggaaatatgaagctgatccagttgaattgtttgaaatcccagtaaaggaatta
acattcgaccaactccagttattgaagctttctcatgtgactgcactaaaaaccaaagac
cagaaacaatgtatggctgaggaggaaaattccttttctgaaaaccaaccatttccttct
cttaagatggttttagagtcattgccagaaaatgtaggatttaatatagaaataaaatgg
atttgccaacacagggatggagtatgggacggcaacttatcgacatattttgatatgaat
gcatttttggatataattttaaaaactgttttagaaaattccgggaagaggagaatagta
ttttcttcatttgatgcagacatctgtacaatggttcggcagaaacaaaacaaatatccc
atattatttttgacccaaggaaagtctgacatttaccctgaactcatggacctcagatct
cggacaacacccattgcaatgagctttgcacagtttgaaaatattttggggataaatgcc
catactgaagatctccttagaaacccatcctatgtccaagaggcaaaagataagggattg
gtcatattctgctggggtgatgataccaatgatcctgaaaacagaaggaaactgaaggaa
tttggagtaaatggtctaatatatgataggatatacgattggatgcctgaacaaccaaat
atattccaagtggagcaactggagcgcctgaagcgagaattgccagagcttaagaactgt
ttgtgtcccactgttagccacttcattcctccttctttctgtatggagtctaaaatccat
gtggatgctaacggcattgataatgtggagaacgcttag

DBGET integrated database retrieval system