KEGG   Rattus norvegicus (rat): 362235
Entry
362235            CDS       T01003                                 

Gene name
Syndig1, DSPC2, RGD1310753, Tmem90b
Definition
(RefSeq) synapse differentiation inducing 1
  KO
K23903  synapse differentiation-inducing gene protein 1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    362235 (Syndig1)
Transporters [BR:rno02000]
 Other transporters
  Accessory factors involved in transport [TC:8]
   362235 (Syndig1)
SSDB
Motif
Pfam: CD225
Other DBs
NCBI-GeneID: 362235
NCBI-ProteinID: NP_001020191
RGD: 1310753
Ensembl: ENSRNOG00000031536
UniProt: Q58DZ9
Position
3q41
AA seq 258 aa
MDGIVEQKSVLVHSKIGDAGKRNGLINTRNFMAESRDGLVSVYPAPQYQSHRLVASAAPG
SLEGGRSDPVQQLLDPNTLQQSVDSHYRPNIILYSDGVLRSWGDGVATDCCETTFIEDRS
PTKDSLEYPDGKFIDLSGDDIKIHTLSYDVEEEEELQELESDYSSDTESEDNFLMMPPRD
HLGLSVFSMLCCFWPLGIAAFYLSHETNKAVAKGDFHQASTSSRRALFLAVLSITIGTGI
YVGVAVALIAYLSKNNHL
NT seq 777 nt   +upstreamnt  +downstreamnt
atggatggcatcgttgagcagaagagtgttctggtacacagtaagatcggtgatgctggc
aaaaggaatggcttaattaacaccagaaacttcatggctgagagcagggatggtctggtg
tctgtttacccagcaccgcagtaccagagccacaggctagtggccagtgcggcaccaggc
agcctggaaggaggcagaagtgatcctgtgcagcagctgctggacccaaacacactgcag
cagtccgtggactcccactatcgtcccaacatcattctatactcagatggtgtgctccga
tcctggggggatggtgtagccactgactgctgtgagaccaccttcattgaggaccggtca
cccaccaaagacagcctggagtaccccgatgggaaattcatcgacctctcaggggatgac
atcaaaatccacaccctgtcttatgatgtggaggaagaggaggagttacaggagctggag
agtgactactctagcgacacagagagtgaggacaacttcctcatgatgcctccacgggat
cacctgggactcagtgtcttctccatgctctgctgcttctggcctttgggcatcgcggcc
ttctacttgtcccatgagacaaacaaagctgtggccaaaggagacttccatcaggccagc
accagctcccggagggccctatttctggcagtgctgtccattacgattggaactggcatc
tatgtgggtgtagctgttgccctcattgcctacctctccaaaaacaaccacctgtga

DBGET integrated database retrieval system