KEGG   Rattus norvegicus (rat): 362242Help
Entry
362242            CDS       T01003                                 

Gene name
Snta1
Definition
(RefSeq) syntrophin, alpha 1
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: PH_17 PDZ PH PDZ_6 PDZ_2
Motif
Other DBs
NCBI-GeneID: 362242
NCBI-ProteinID: NP_001094371
RGD: 1307068
Ensembl: ENSRNOG00000016062
UniProt: B5DFL0
Position
3q41
AA seq 499 aa AA seqDB search
MASGRRAPRTGLLELRSGAGSGAGGERWQRVLLTLAEDALTVSPADGEPGPEPEPAQLNG
AAEPGAASPQLPEALLLQRRRVTVRKADAGGLGISIKGGRENKMPILISKIFKGLAADQT
EALFVGDAILSVNGEDLSSATHDEAVQALKKTGKEVVLEVKYMKEVSPYFKNSAGGTSVG
WDSPPASPLQRQPSSPGPQPRNLNEAKHVSLKMAYVSRRCTPTDPEPRYLEICAADGQDT
LFLRAKDEASARSWAGAIQAQISTFIPWVKDELQALLTATGTAGSQDIKQIGWLTEQLPS
GGTAPTLALLTEKELLLYCSLPQTREALSRPARTAPLIATRLVHSGPSKGSVPYDAELSF
ALRTGTRHGVDTHLFSVESPQELAAWTRQLVDGCHRAAEGVQEVSTACTWNGRPCNLSVH
IDKGFTLWAAEPGATRAVLLRQPFEKLQMSSDDGMSLLFLDFGGAEGEIQLDLHSCPKTM
VFIIHSFLSAKVTRLGLLA
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcaggcaggcgcgctccgcgcaccgggttgctagaactgcgctccggggcgggc
tccggggcgggtggtgagcggtggcagcgggtgttgctcactctggcggaggacgcgctg
accgtgagccccgccgacggcgagcccggcccggagcccgagcccgcgcagctcaacggc
gccgctgagcccggcgcggcgtccccacagctgccagaggcgctgctgctccagcggcgc
cgcgtgacggtgcgcaaggccgacgccggcgggctcggcatcagcatcaagggaggccgg
gaaaacaagatgcctattctcatttccaagatcttcaaggggctggcagcagaccagacg
gaggccctctttgtcggcgatgccatcctctctgtgaatggtgaagatttgtcctctgcc
acccatgatgaagcagtacaggccctcaagaagacgggcaaggaggttgtgttggaggtt
aagtatatgaaggaggtctcaccgtatttcaagaattctgctggtgggacctccgttggc
tgggactcacctcctgcctcgcctcttcagcgtcagccttcttcccctggcccccaaccc
cggaacctcaatgaggccaaacatgtatctttgaagatggcgtatgtctcaaggaggtgt
acccccactgacccggagcccaggtatctggagatctgtgcagcagatggccaggacact
ctcttcttgagggccaaggatgaggccagtgcaaggtcatgggcaggtgccatccaagct
cagatcagcacatttataccttgggtcaaggatgagctgcaggcgctgctgacagccaca
ggtacagctgggagccaggacatcaagcagattggctggctcacggaacagttgcccagt
gggggtacagcaccaaccctggccctgctgactgagaaggagctgctcctctactgctct
ctcccccagactcgagaggccctgagcaggccggcccgcactgccccgctcattgccacc
aggctggtgcactcaggcccttccaagggctcagtgccctatgatgcagagctctccttt
gccctgcgcacgggtacacgccacggtgtggacactcacctgttcagtgtggagtcgccg
caggagctggcagcctggacccgacagttggtggatggctgtcaccgggctgctgaaggt
gtgcaagaagtgtctacagcctgcacgtggaatggccgtccctgcaacctatccgtgcac
attgacaagggcttcacactgtgggcagctgagccaggagcaacccgagctgtgctgctc
cgacagccctttgagaaacttcagatgtcatcagatgatggcatgagtctccttttcctg
gactttgggggtgctgaaggagagatccagctggacctgcattcgtgtcccaaaaccatg
gtctttatcatccactctttcctgtctgccaaggtcacccgcttggggctcttggcctag

DBGET integrated database retrieval system