KEGG   Rattus norvegicus (rat): 362245
Entry
362245            CDS       T01003                                 

Gene name
Map1lc3a, LC3-I, LC3-II, LC3A
Definition
(RefSeq) microtubule-associated protein 1 light chain 3 alpha
  KO
K10435  microtubule-associated protein 1 light chain
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04216  Ferroptosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    362245 (Map1lc3a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    362245 (Map1lc3a)
   03029 Mitochondrial biogenesis [BR:rno03029]
    362245 (Map1lc3a)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    362245 (Map1lc3a)
Membrane trafficking [BR:rno04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    362245 (Map1lc3a)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Other mitophagy factors
    362245 (Map1lc3a)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Microtubule-associated proteins (MAPs)
     362245 (Map1lc3a)
SSDB
Motif
Pfam: Atg8 APG12
Other DBs
NCBI-GeneID: 362245
NCBI-ProteinID: NP_955794
RGD: 735183
Ensembl: ENSRNOG00000025443
UniProt: Q6XVN8
Position
3q41
AA seq 121 aa
MPSDRPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNM
SELVKIIRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYEQEKDEDGFLYMVYASQETFG
F
NT seq 366 nt   +upstreamnt  +downstreamnt
atgccctccgaccggcctttcaagcagcggcgcagcttcgccgaccgctgtaaggaggtg
cagcagatccgtgaccagcaccccagcaagatcccggtgatcatcgagcgctacaagggt
gagaagcagctgcctgtcctggataagaccaagtttctggtcccagaccatgttaacatg
agcgagttggtcaagatcatccggcgccgcctgcaactcaaccccacgcaggccttcttc
ctgctggtgaaccagcacagcatggtgagtgtatccacacccatcgctgacatctatgaa
caggagaaggatgaagacggattcctctacatggtctatgcctcccaagaaaccttcggc
ttctga

DBGET integrated database retrieval system