KEGG   Rattus norvegicus (rat): 362248Help
Entry
362248            CDS       T01003                                 

Gene name
Procr
Definition
(RefSeq) protein C receptor
  KO
K06557  protein C receptor, endothelial (EPCR)
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04610  Complement and coagulation cascades
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    362248 (Procr)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:rno04090]
    362248 (Procr)
CD molecules [BR:rno04090]
 Proteins
  362248 (Procr)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MHC_I_3 MHC_I
Motif
Other DBs
NCBI-GeneID: 362248
NCBI-ProteinID: NP_001020904
RGD: 1305991
Ensembl: ENSRNOG00000019330
UniProt: Q4V8I1
Position
3q42
AA seq 241 aa AA seqDB search
MLTKFLSLLLLLLLLGCAFCNSDGSQSLHMLQISYFPDPYHGRHQGNASLGKLLTHTLEG
PSNNVTILQLQDWQDPDSWARTESGLKIYLSQFNSLVQLIYRERKNDVVFPLTVSCSVGC
ELPPEEGSEPHVFFDVAVNGSAFVSFQPKTAIWVTGSQEPSEAINFTLKQLNTYNRTRYE
LQEFLQDTCVQYLENHITTQNTKGSQTGRSYTSLVLGILMGCFIIAGVAVGIFLCTGGRR
C
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgttgacgaagtttctgtcgctgctgctgctgctgctgctgcttggctgcgccttttgt
aactccgatggctcccaaagcctgcacatgctccagatctcctacttcccagacccctat
cacgggaggcatcagggcaacgcctctctgggaaaactcctgacacacacgctggaaggc
ccgagcaacaacgtcaccattctccagctccaggactggcaggatccggatagctgggcg
cgcacagagagtggcctgaagatctacctgtcccagttcaacagcctggtgcagttgatc
tatcgcgagcgcaagaacgacgtggtctttcctctgactgttagctgctccgtgggctgt
gagctgccgccagaggagggctctgaaccccatgtcttctttgatgtggctgtgaatgga
agtgccttcgtaagtttccagccaaagactgccatatgggtgacaggctcccaggagccc
tccgaagccatcaacttcaccctgaagcaactcaatacctacaatcggactcggtatgaa
ctgcaggaatttctgcaggacacctgtgtgcagtacctggagaaccacatcaccacgcaa
aacaccaaagggagccaaacaggccgctcttatacttcactggtcctgggtatcctgatg
ggctgtttcataatcgctggtgtggccgtgggcatcttcctgtgcacgggtggacggcgt
tgctaa

DBGET integrated database retrieval system