KEGG   Rattus norvegicus (rat): 362265
Entry
362265            CDS       T01003                                 

Gene name
Ift52, RGD1311004
Definition
(RefSeq) intraflagellar transport 52
  KO
K19681  intraflagellar transport protein 52
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    362265 (Ift52)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Intraflagellar transport (IFT) complex B
    362265 (Ift52)
SSDB
Motif
Pfam: ABC_transp_aux DUF4159
Other DBs
NCBI-GeneID: 362265
NCBI-ProteinID: NP_001171156
RGD: 1311004
Ensembl: ENSRNOG00000007692
UniProt: B1WC53
Position
3q42
AA seq 370 aa
MEKELRSTILFNAYKKEVFTTNTGYKSLQKRLRSNWKIQSLKDEITSEKLIGVKLWITAG
PREKFTAAEFEVLKKYLDSGGDILVMLGEGGESRFDTNINFLLEEYGIMVNNDAVVRNVY
YKYFHPKEALVSDGVLNREISRAAGKAVPGVIDEENSGNNAQALTFVYPYGATLSVMKPA
VAVLSTGSVCFPLNRPILAFYHSKNQGFGKLAVLGSCHMFSDQYLDKEENSKIMDVVFQW
LTTGDIHLNQIDAEDPEISDYTMVPDTATLSEQLRVCLQEGDENPRDFTTLFDLSIYQLD
TTCLPKVIKAHEELNVKHEPLQLVQPQFEMPLPALQPAALRNSWLKDCISPRSSLQVSGS
CHPLPWSCLT
NT seq 1113 nt   +upstreamnt  +downstreamnt
atggagaaggagctgaggagtaccattcttttcaatgcatacaaaaaggaggtgtttacc
accaacactggctacaaatctttgcagaaaagacttcggagtaattggaagattcagagc
ttaaaagatgaaatcacttctgagaagttaattggggtgaaactatggatcacagctgga
ccaagggaaaagtttactgctgcagagtttgaagtcctgaagaagtaccttgacagtggt
ggggacatccttgtgatgctgggagaagggggagaatccagatttgataccaatattaac
ttccttctagaagaatatggaatcatggttaataatgatgctgtggttagaaatgtgtat
tacaagtatttccatcctaaggaagctctggtttcagacggagtgttgaacagagagatt
agccgagctgcagggaaggctgtgcctggagtcattgatgaagagaacagtggaaacaat
gcccaggctctcacctttgtctacccttatggtgccacattgagcgtcatgaaaccagca
gtggctgttctgtccacaggctctgtctgcttcccactgaacaggcccattctggctttc
tatcactcaaagaaccaaggttttggaaagctggcagtgctgggctcgtgtcatatgttc
agtgaccaatatttagataaagaagaaaatagcaaaattatggacgttgtgttccagtgg
ctcacaacaggagacatccacctaaaccagattgatgctgaggacccagagatttccgac
tacacgatggtgccagacacagccaccctttcagagcagctccgagtgtgtctccaggaa
ggcgatgagaacccccgtgactttaccaccctctttgacctgtccatttaccagctggac
accacctgcctccccaaggtcatcaaggctcacgaggaactaaatgtgaagcatgaacca
ctgcagctcgtccaacctcagtttgagatgccgctgccagcccttcagcctgcggctctg
agaaactcttggctgaaagactgcatctcccctaggtcttccctccaagtttccgggagc
tgccaccccctcccctggagctgtttgacctag

DBGET integrated database retrieval system